Align Histidine transport system permease protein HisQ (characterized)
to candidate RR42_RS31740 RR42_RS31740 ABC transporter permease
Query= SwissProt::P52094 (228 letters) >FitnessBrowser__Cup4G11:RR42_RS31740 Length = 222 Score = 112 bits (281), Expect = 4e-30 Identities = 72/218 (33%), Positives = 116/218 (53%), Gaps = 18/218 (8%) Query: 9 ILQGALVTLELAISSVVLAVIIGLIGAGGKLSQNR--LSGLIFEGYTTLIRGVPDLVLML 66 +++GA VT+E+ ++VL ++GL+ G+L R + GL Y T IRG P LV + Sbjct: 15 LVRGAGVTVEVTACALVLGCVMGLLVGIGRLDPRRRVVYGLC-TAYVTAIRGTPLLVQLF 73 Query: 67 LIFYGLQIALNTVTEAMGVGQIDI--DPMVAGIITLGFIYGAYFTETFRGAFMAVPKGHI 124 L+F+GL Q DI V G+I LG GAY +E RGA +V KG + Sbjct: 74 LLFFGLP-------------QFDILLPAFVCGVIGLGIYSGAYVSEIVRGAIQSVDKGQM 120 Query: 125 EAATAFGFTRGQVFRRIMFPSMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKATQLAG 184 EAA + G + GQ R ++ P + +P +GN + ++K++ALVSLL + DV+ Q Sbjct: 121 EAARSIGMSSGQAMRAVILPQAIVRMIPPLGNEFIALIKNSALVSLLTIHDVMHEGQKII 180 Query: 185 KSTWEPFYFAIVCGVIYLVFTTVSNGVLLFLERRYSVG 222 ++ + ++YL+ T+ + L +E+R +G Sbjct: 181 SVSYRSLEVYLAIALVYLLLTSAAGLFLRHMEQRLRMG 218 Lambda K H 0.328 0.145 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 222 Length adjustment: 22 Effective length of query: 206 Effective length of database: 200 Effective search space: 41200 Effective search space used: 41200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory