Align Formiminoglutamase (EC 3.5.3.8) (characterized)
to candidate RR42_RS31730 RR42_RS31730 formimidoylglutamase
Query= reanno::Koxy:BWI76_RS08725 (318 letters) >FitnessBrowser__Cup4G11:RR42_RS31730 Length = 313 Score = 258 bits (660), Expect = 1e-73 Identities = 152/310 (49%), Positives = 192/310 (61%), Gaps = 12/310 (3%) Query: 10 ALWQGRDDSAEAANALRLFQTIVRAERFEPEMLAGDIALLGFACDEGVRRNKGRTGAERG 69 ++WQGR D+ E + RLF + A P AG ++GFACD GV RN GR GA +G Sbjct: 8 SVWQGRSDAGERGDTRRLFHVVRAAGAPLP---AGSPVVVGFACDAGVLRNHGRAGAAQG 64 Query: 70 PETLRRALANMASHDGHDRCVDMGTIHVADDALEAAQQALREAVTACQRAGKRTLVLGGG 129 P+ +RRALAN+ +H G D G + DDALEAAQ+ L AV A G LVLGGG Sbjct: 65 PDAIRRALANVPAH-GLPALYDAGNVICEDDALEAAQERLAGAVRAVLDGGGLPLVLGGG 123 Query: 130 HETAFGHGAGV---LDAF-PGEEVGIINLDAHLDLRIADRASSGTPFRQLALACEAQRRA 185 HE A+G G+ LDA G + I+N+DAH DLR + ASSGTPF Q+A CE+ RR Sbjct: 124 HEVAWGSWQGLRAHLDAAGDGGRLLIVNIDAHFDLRTSRPASSGTPFDQIA--CESARRG 181 Query: 186 --FHYACIGVSRAANTQALLDEAARRGVTIIEDLDVLNAFEARAIPELARNIARYDRLYL 243 F Y C+GVSR ANT AL A GV+ +ED+D+ + L +A + +YL Sbjct: 182 LPFDYVCLGVSRLANTPALFARADELGVSYVEDVDLQERHLDARLAALRERMALAEHVYL 241 Query: 244 TIDLDVLPAREMPAVSAPAALGIPLATLLRIVEPLCRSGKLQAVDLVEFNPQYDIDSQGA 303 TIDLD LPA MP VSAPAA G+PLA + +V + RSGKL+ DL E+NP YD D QGA Sbjct: 242 TIDLDALPAAVMPGVSAPAAFGVPLAVVEALVGEVRRSGKLRVADLAEYNPSYDRDHQGA 301 Query: 304 RAAARLAWQI 313 R AARLA+++ Sbjct: 302 RVAARLAYRL 311 Lambda K H 0.322 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 328 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 313 Length adjustment: 27 Effective length of query: 291 Effective length of database: 286 Effective search space: 83226 Effective search space used: 83226 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate RR42_RS31730 RR42_RS31730 (formimidoylglutamase)
to HMM TIGR01227 (hutG: formimidoylglutamase (EC 3.5.3.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01227.hmm # target sequence database: /tmp/gapView.22936.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01227 [M=307] Accession: TIGR01227 Description: hutG: formimidoylglutamase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-88 282.5 0.0 2.3e-88 282.3 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS31730 RR42_RS31730 formimidoylglutamas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS31730 RR42_RS31730 formimidoylglutamase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 282.3 0.0 2.3e-88 2.3e-88 1 306 [. 10 312 .. 10 313 .] 0.95 Alignments for each domain: == domain 1 score: 282.3 bits; conditional E-value: 2.3e-88 TIGR01227 1 lqgrldleeaskkrrdeqvakvvdlveledaqdekgvaliGvaldkgvirnkGrtGAkeaPsairqala 69 +qgr d e ++ rr ++v++ +l+ ++++G+a+d+gv rn+Gr GA ++P+air+ala lcl|FitnessBrowser__Cup4G11:RR42_RS31730 10 WQGRSDAGERGDTRRLFHVVRAAGA-PLP----AGSPVVVGFACDAGVLRNHGRAGAAQGPDAIRRALA 73 99*****************998877.663....45699******************************* PP TIGR01227 70 nlgdlvasealyDlGdivlegddlvdaqkevaqavaelladarvvvllGGdneiayatikalaqa..ak 136 n ++ alyD+G++ +e+d l++aq+ +a av+++l+ + ++++lGG++e+a+ + ++l+++ a lcl|FitnessBrowser__Cup4G11:RR42_RS31730 74 NV-PAHGLPALYDAGNVICEDDALEAAQERLAGAVRAVLDGGGLPLVLGGGHEVAWGSWQGLRAHldAA 141 **.5667789*******************************************************7755 PP TIGR01227 137 gek.riGvinfDAHfDlRavederptsGTpfrqlldeeqaed..fhlivlGirrfsntqalfdyakkkg 202 g+ r ++n+DAHfDlR+ ++sGTpf q++ e + f +++lG++r+ nt+alf++a+++g lcl|FitnessBrowser__Cup4G11:RR42_RS31730 142 GDGgRLLIVNIDAHFDLRTSR--PASSGTPFDQIACESARRGlpFDYVCLGVSRLANTPALFARADELG 208 5547999***********998..9********************************************* PP TIGR01227 203 vryvtddalaelsletikdileefldevDfiyltvdlDVldaasAPGvsApaagGleleellelvkria 271 v+yv+d l+e +l+ +++l+e + +++ylt+dlD l+aa PGvsApaa G+ l ++++lv + lcl|FitnessBrowser__Cup4G11:RR42_RS31730 209 VSYVEDVDLQERHLDARLAALRERMALAEHVYLTIDLDALPAAVMPGVSAPAAFGVPLAVVEALVGEVR 277 ********************************************************************* PP TIGR01227 272 asdkvrgveivEvnPtlDaddrTarlaArlvahll 306 +s+k+r+++++E+nP++D d++ ar+aArl ll lcl|FitnessBrowser__Cup4G11:RR42_RS31730 278 RSGKLRVADLAEYNPSYDRDHQGARVAARLAYRLL 312 *****************************987766 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (307 nodes) Target sequences: 1 (313 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.49 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory