Align N-formylglutamate deformylase (EC 3.5.1.68) (characterized)
to candidate RR42_RS16895 RR42_RS16895 N-formylglutamate amidohydrolase
Query= reanno::Cup4G11:RR42_RS16895 (271 letters) >FitnessBrowser__Cup4G11:RR42_RS16895 Length = 271 Score = 551 bits (1421), Expect = e-162 Identities = 271/271 (100%), Positives = 271/271 (100%) Query: 1 MAFSTDTPAFTLHRGTRPMLVSMPHVGTHLPACVSDRLTAEARTVPDTDWHLERLYDFAR 60 MAFSTDTPAFTLHRGTRPMLVSMPHVGTHLPACVSDRLTAEARTVPDTDWHLERLYDFAR Sbjct: 1 MAFSTDTPAFTLHRGTRPMLVSMPHVGTHLPACVSDRLTAEARTVPDTDWHLERLYDFAR 60 Query: 61 ELGASILVATHSRYVVDLNRPPDNANLYPGQDTTGLCPVDTFDKTPIYADASGLPADDEI 120 ELGASILVATHSRYVVDLNRPPDNANLYPGQDTTGLCPVDTFDKTPIYADASGLPADDEI Sbjct: 61 ELGASILVATHSRYVVDLNRPPDNANLYPGQDTTGLCPVDTFDKTPIYADASGLPADDEI 120 Query: 121 AARRDAIWRPYHGALAEELARLRAEHGTVALWDAHSIRSVLPRFFEGKLTDFNLGTANGA 180 AARRDAIWRPYHGALAEELARLRAEHGTVALWDAHSIRSVLPRFFEGKLTDFNLGTANGA Sbjct: 121 AARRDAIWRPYHGALAEELARLRAEHGTVALWDAHSIRSVLPRFFEGKLTDFNLGTANGA 180 Query: 181 SCDAALANQLLDIAGALPGYTSVLNGRFKGGYITRQYGAPAQGVQAVQLELTQSAYMSET 240 SCDAALANQLLDIAGALPGYTSVLNGRFKGGYITRQYGAPAQGVQAVQLELTQSAYMSET Sbjct: 181 SCDAALANQLLDIAGALPGYTSVLNGRFKGGYITRQYGAPAQGVQAVQLELTQSAYMSET 240 Query: 241 YPFAYDEARATRIQPTLKTMLETVLGYVEAR 271 YPFAYDEARATRIQPTLKTMLETVLGYVEAR Sbjct: 241 YPFAYDEARATRIQPTLKTMLETVLGYVEAR 271 Lambda K H 0.320 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 271 Length of database: 271 Length adjustment: 25 Effective length of query: 246 Effective length of database: 246 Effective search space: 60516 Effective search space used: 60516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate RR42_RS16895 RR42_RS16895 (N-formylglutamate amidohydrolase)
to HMM TIGR02017 (hutG: N-formylglutamate deformylase (EC 3.5.1.68))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02017.hmm # target sequence database: /tmp/gapView.9893.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02017 [M=263] Accession: TIGR02017 Description: hutG_amidohyd: N-formylglutamate deformylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-111 357.9 0.0 1.9e-111 357.7 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS16895 RR42_RS16895 N-formylglutamate a Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS16895 RR42_RS16895 N-formylglutamate amidohydrolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 357.7 0.0 1.9e-111 1.9e-111 3 261 .. 10 268 .. 8 270 .. 0.98 Alignments for each domain: == domain 1 score: 357.7 bits; conditional E-value: 1.9e-111 TIGR02017 3 levqrGkaPllislPhtGtdltdavesrlvsaakalkdtdWhieklydfardlGatvvraaisrlvidv 71 ++++rG+ P+l+s+Ph Gt+l+ v++rl+++a+++ dtdWh+e+lydfar+lGa+++ a+ sr+v+d+ lcl|FitnessBrowser__Cup4G11:RR42_RS16895 10 FTLHRGTRPMLVSMPHVGTHLPACVSDRLTAEARTVPDTDWHLERLYDFARELGASILVATHSRYVVDL 78 6789***************************************************************** PP TIGR02017 72 nrdpsgaslypgqattgliPettfdgeplykdGea.PseaeikkrltkyfkPyhaalraeierlralhg 139 nr+p++a lypgq ttgl+P +tfd +p+y d P ++ei+ r++ +++Pyh al++e++rlra hg lcl|FitnessBrowser__Cup4G11:RR42_RS16895 79 NRPPDNANLYPGQDTTGLCPVDTFDKTPIYADASGlPADDEIAARRDAIWRPYHGALAEELARLRAEHG 147 ******************************997644********************************* PP TIGR02017 140 kivlydahsirsviPrlfeGklPdfnlGtndgkscdpaladaveavcakakglssvlnGrfkGGyitrh 208 ++ l+dahsirsv+Pr+feGkl dfnlGt +g+scd ala+++ +++ g++svlnGrfkGGyitr+ lcl|FitnessBrowser__Cup4G11:RR42_RS16895 148 TVALWDAHSIRSVLPRFFEGKLTDFNLGTANGASCDAALANQLLDIAGALPGYTSVLNGRFKGGYITRQ 216 ************************************************9******************** PP TIGR02017 209 ygqPqngvhavqlelaqrgyleeetePvaydeakaealravlkellealldfa 261 yg P++gv avqlel+q++y++ et P+aydea+a+ ++ +lk++le++l + lcl|FitnessBrowser__Cup4G11:RR42_RS16895 217 YGAPAQGVQAVQLELTQSAYMS-ETYPFAYDEARATRIQPTLKTMLETVLGYV 268 **********************.*************************99775 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (271 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.78 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory