Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate RR42_RS20235 RR42_RS20235 metal-dependent hydrolase
Query= TCDB::P73650 (240 letters) >FitnessBrowser__Cup4G11:RR42_RS20235 Length = 247 Score = 203 bits (517), Expect = 2e-57 Identities = 115/244 (47%), Positives = 155/244 (63%), Gaps = 8/244 (3%) Query: 1 MSDLLVVKDVFAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLT---P 57 MS +L VKD+ Y V + G N + G++VTVIGPNGAGKST+ I G L Sbjct: 1 MSLILEVKDLHVRY-GKVEAVHGANLKVEAGKIVTVIGPNGAGKSTMLNAIMGALPVSGS 59 Query: 58 SQGEIIFKGENITGLGSDQIVRRGMCYVPQVCNVFGSLTVAENLDMGAFLHQ--GPTQTL 115 S G + + G ++ GL ++ V RGMC VP+ +FGS++VA+NL +GA+ + G L Sbjct: 60 STGAVTYLGHDLAGLPAEGRVARGMCLVPEKRELFGSMSVADNLVLGAYRRKRAGEKNFL 119 Query: 116 KDR--IYTMFPKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVK 173 +Y +FP+L +R Q AGTLSGGERQMLA+GRALM P LL+LDEPS L+P++VK Sbjct: 120 DQMEVVYGLFPRLKERAKQDAGTLSGGERQMLAVGRALMAKPQLLMLDEPSLGLAPLIVK 179 Query: 174 DVFAQIKAINATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVGELY 233 ++F I + TG A +L+EQNA+ AL +AD GYV+E G +EG L +P V E Y Sbjct: 180 EIFHIINDLRKTGVATLLIEQNARAALQVADYGYVIETGDMAMEGPAGELAANPKVIETY 239 Query: 234 LGAA 237 LG A Sbjct: 240 LGLA 243 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 247 Length adjustment: 23 Effective length of query: 217 Effective length of database: 224 Effective search space: 48608 Effective search space used: 48608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory