Align acyl-CoA dehydrogenase subunit (EC 1.3.8.4; EC 1.3.8.5) (characterized)
to candidate RR42_RS00870 RR42_RS00870 isovaleryl-CoA dehydrogenase
Query= metacyc::MONOMER-11693 (386 letters) >FitnessBrowser__Cup4G11:RR42_RS00870 Length = 396 Score = 245 bits (625), Expect = 2e-69 Identities = 151/384 (39%), Positives = 214/384 (55%), Gaps = 12/384 (3%) Query: 5 LTPELEELRRTVEEFAHDVVAPKIGDFYERHEFPYEIVREMGRMGLFGLPFPEEYGGMGG 64 L ++E LR TV +A +AP+ + +FP + ++MG +G+ G+ EEYGG Sbjct: 14 LGEDIEMLRETVCNWAQAELAPRAAEIDRTDQFPMDAWKKMGDLGVLGITVAEEYGGANM 73 Query: 65 DYLALGIALEELARVDSSVAITLEAGVSLGAMPIHLFGTDAQKAEWLPRLCSGEILGAFG 124 YLA IA+EE++R +SV ++ A +L IH GT AQKA +LP+L SG+ +GA Sbjct: 74 GYLAHMIAMEEISRASASVGLSYGAHSNLCVNQIHRNGTAAQKARYLPKLVSGDWIGALA 133 Query: 125 LTEPDGGSDAGATRTTARLDESTNEWVINGTKCFITNSGTDITGLVTVTAVTGRKPD-GK 183 ++EP+ GSD + + R D + +V+NGTK +ITN G D LV +PD G Sbjct: 134 MSEPNAGSDVVSMK--LRADFKGDHYVLNGTKMWITN-GPDCDVLVVYAKT---EPDLGA 187 Query: 184 PLISSIIVPSGTPGFTVAAPYSKVGWNASDTRELSFADVRVPAANLLGEQGRGYAQFLRI 243 +++ IV G GF+VA K+G S T EL F DV VP N+LG + G + Sbjct: 188 RGMTAFIVEKGMKGFSVAQKLDKLGMRGSHTGELVFQDVEVPVENILGGENLGAKVLMSG 247 Query: 244 LDEGRIAISALATGLAQGCVDESVKYAGERHAFGRNIGAYQAIQFKIADMEMKAHMARVG 303 LD R +S G+ Q C+D Y +R FG++IG +Q IQ K+ADM AR Sbjct: 248 LDYERAVLSGGPVGIMQACMDVITPYIHDRKQFGQSIGEFQLIQGKVADMYTTLQAARSY 307 Query: 304 WRDAASRLVA-----GEPFKKEAAIAKLYSSTVAVDNAREATQIHGGYGFMNEYPVARMW 358 L + +K+ A LY++ A A E+ QI GG G++NEYPV R+W Sbjct: 308 LYTVGKNLDSLGKDHVRQVRKDCAAVILYTAEKATWMAGESVQILGGNGYINEYPVGRLW 367 Query: 359 RDSKILEIGEGTSEVQRMLIAREL 382 RD+K+ EIG GTSE++RMLI REL Sbjct: 368 RDAKLYEIGAGTSEIRRMLIGREL 391 Lambda K H 0.318 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 396 Length adjustment: 31 Effective length of query: 355 Effective length of database: 365 Effective search space: 129575 Effective search space used: 129575 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory