Align 3-methyl-2-oxobutanoate dehydrogenase subunit alpha; Branched-chain alpha-ketoacid dehydrogenase E1 component subunit alpha; BCKADH E1-alpha; EC 1.2.4.4 (characterized)
to candidate RR42_RS33045 RR42_RS33045 pyruvate dehydrogenase
Query= SwissProt::P9WIS3 (367 letters) >FitnessBrowser__Cup4G11:RR42_RS33045 Length = 355 Score = 238 bits (606), Expect = 2e-67 Identities = 142/343 (41%), Positives = 183/343 (53%), Gaps = 7/343 (2%) Query: 16 DLEPVQLVGPDGTPTAERRYHRDLPEETLRWLYEMMVVTRELDTEFVNLQRQGELALYTP 75 D+E Q + P G PT L E L LY MV+TR+ D + + LQR G++ + Sbjct: 8 DIEYTQFLDPQGEPTQALPAFA-LDPEALLPLYRAMVLTRQFDLKAIALQRTGQIGTFAS 66 Query: 76 CRGQEAAQVGAAACLRKTDWLFPQYRELGVYLVRGIPPGHVGVAWRGTWHGGLQFTTKCC 135 GQEA VG A+ +R D L P YR+ RG+ + W G G Sbjct: 67 ALGQEAVGVGVASAMRAQDVLVPSYRDHAAQFQRGVSMTESLLYWGGDERGNAFAAAPHD 126 Query: 136 APMSVPIGTQTLHAVGAAMAAQRLDEDSVTVAFLGDGATSEGDVHEALNFAAVFTTPCVF 195 VPIG Q HA G A A + E TV LGDG TS+GD +E +N A + P V Sbjct: 127 FANCVPIGNQVCHAAGIAYAMKLRREPRATVCLLGDGGTSKGDFYEGMNMAGAWHAPLVL 186 Query: 196 YVQNNQWAISMPVSRQTAAPSIAHKAIGYGMPGIRVDGNDVLACYAVMAEAAARARAGDG 255 V NNQWAISMP S+QTAA ++A KAI G+PG++VDGNDV+A V +A RAR G G Sbjct: 187 VVNNNQWAISMPRSQQTAARTLAQKAIAAGIPGLQVDGNDVVAVRQVTLDALERARGGGG 246 Query: 256 PTLIEAVTYRLGPHTTADDPTRYRSQEEVDRWATLDPIPRYRTYLQDQGLWSQRLEEQVT 315 TLIEA+TYRLG HTTADD +RYR E+V + L+P+ R R YL G W E+ Sbjct: 247 ATLIEAITYRLGDHTTADDASRYRDSEQVRQHWLLEPVARLRNYLLRLGAWDAPRED--- 303 Query: 316 ARAKHVRSELRDAV---FDAPDFDVDEVFTTVYAEITPGLQAQ 355 A AK +++ AV P + +F +YA + L Q Sbjct: 304 ALAKDCAAQVAAAVQAYLATPLPETAAMFDCLYASLPKALAGQ 346 Lambda K H 0.320 0.134 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 328 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 355 Length adjustment: 29 Effective length of query: 338 Effective length of database: 326 Effective search space: 110188 Effective search space used: 110188 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory