Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate RR42_RS28550 RR42_RS28550 enoyl-CoA hydratase
Query= BRENDA::Q9I5I4 (272 letters) >FitnessBrowser__Cup4G11:RR42_RS28550 Length = 256 Score = 313 bits (802), Expect = 2e-90 Identities = 161/248 (64%), Positives = 190/248 (76%), Gaps = 1/248 (0%) Query: 25 GHTALITINHPPANTWDRDSLIGLRQLIEHLNRDDDIYALVVTGQGPKFFSAGADLNMFA 84 GH A +T+ PPAN ++ + L L+QL+ LN D + A+V+TG G +FFSAGADLN FA Sbjct: 8 GHIARLTLKRPPANAFNAEGLAQLQQLVATLNADTRVRAIVITGDGSRFFSAGADLNGFA 67 Query: 85 DGDKARAREMARRFGEAFEALRDFRGVSIAAINGYAMGGGLECALACDIRIAERQAQMAL 144 DGD+A AR MA+RFG AFEAL++ R + IAAINGYAMGGGLECALACD+RIAE QAQMAL Sbjct: 68 DGDRAHARLMAQRFGAAFEALQNARPLVIAAINGYAMGGGLECALACDVRIAEEQAQMAL 127 Query: 145 PEAAVGLLPCAGGTQALPWLVGEGWAKRMILCNERVDAETALRIGLVEQVVDSGEARGAA 204 PEA VGLLPC GTQ LPWLVGEGWAKRMIL NER+DA TALRIGLVE++V +G+A AA Sbjct: 128 PEAGVGLLPCGCGTQTLPWLVGEGWAKRMILANERIDAATALRIGLVEEMVPTGQALDAA 187 Query: 205 LLLAAKVARQSPVAIRTIKPLIQGARERAP-NTWLPEERERFVDLFDAQDTREGVNAFLE 263 L LA + + SP A K L+ AR+ P L ERERFVDLFD +D REGVNAFL+ Sbjct: 188 LRLAERASNVSPRAAAYSKQLVHLARQGVPRGPALALERERFVDLFDGEDQREGVNAFLQ 247 Query: 264 KRDPKWRN 271 KR P+WRN Sbjct: 248 KRAPQWRN 255 Lambda K H 0.321 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 256 Length adjustment: 25 Effective length of query: 247 Effective length of database: 231 Effective search space: 57057 Effective search space used: 57057 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory