Align 3-hydroxyacyl-CoA dehydrogenase IvdG; EC 1.1.1.35 (characterized, see rationale)
to candidate RR42_RS17660 RR42_RS17660 3-oxoacyl-ACP synthase
Query= uniprot:Q8EGC1 (252 letters) >FitnessBrowser__Cup4G11:RR42_RS17660 Length = 246 Score = 166 bits (419), Expect = 5e-46 Identities = 102/256 (39%), Positives = 144/256 (56%), Gaps = 14/256 (5%) Query: 1 MDLKDKVVVITGGAGGLGLAMAHNFAQAGAKLALIDVDQDKLERACADLGSS-TEVQGYA 59 M L+ +V +ITG A G+G A A FA GA + L DV ++++ A L +S V Y Sbjct: 1 MKLQGRVAIITGAAAGIGFATAQRFAAEGALVVLCDVQEERVRAAAETLAASGATVSAYK 60 Query: 60 LDITDEEDVVAGFAYILEDFGKINVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQSVIN 119 +D+T ++V A A L G++++LVNNAGI +D L K M+ QF +VI+ Sbjct: 61 VDVTRRDEVDAMVAATLARHGRVDILVNNAGITKDARLTK---------MTEAQFDAVID 111 Query: 120 VNLTGTFLCGREAAAAMIESGQAGVIVNISSLAKA-GNVGQSNYAASKAGVAAMSVGWAK 178 VNL G F C + A M E G+ GVI+N SS+ GN GQ+NYAASK GV ++ WA+ Sbjct: 112 VNLKGVFNCAQAVADIMTEQGK-GVILNASSVVGLYGNFGQTNYAASKFGVIGLTKTWAR 170 Query: 179 ELARYNIRSAAVAPGVIATEMTAAMKPEALERLEKLVPVGRLGHAEEIASTVRFIIEND- 237 EL +R AV PG +ATE+ + + L+ ++ + RL EIAS F+ +D Sbjct: 171 ELGPKGVRVNAVCPGFVATEILQTVPEKVLDGMKSSCWLRRLAQPAEIASIYTFLASDDA 230 Query: 238 -YVNGRVFEVDGGIRL 252 YVNG E GG+ L Sbjct: 231 SYVNGVAIEASGGMSL 246 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 246 Length adjustment: 24 Effective length of query: 228 Effective length of database: 222 Effective search space: 50616 Effective search space used: 50616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory