Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate RR42_RS16965 RR42_RS16965 ABC transporter
Query= uniprot:A0A165KC86 (260 letters) >FitnessBrowser__Cup4G11:RR42_RS16965 Length = 258 Score = 382 bits (981), Expect = e-111 Identities = 192/257 (74%), Positives = 222/257 (86%), Gaps = 1/257 (0%) Query: 5 SNE-VVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDA 63 SNE ++L V G++KRFGGLQALSDVG+ IK G++YGLIGPNGAGKTTFFNVITGLYTPD+ Sbjct: 2 SNENLLLSVQGVNKRFGGLQALSDVGLQIKPGEIYGLIGPNGAGKTTFFNVITGLYTPDS 61 Query: 64 GTFELAGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFR 123 G F L GK Y+PTAVHEVAKAGIARTFQNIRLF EMTALENVMVGRH+RT +GLFGAVFR Sbjct: 62 GEFVLGGKAYQPTAVHEVAKAGIARTFQNIRLFGEMTALENVMVGRHVRTKAGLFGAVFR 121 Query: 124 TKGFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDE 183 + EE ++ A +LL+YVGIGK+A + +R LSYG QRRLEIARALAT+P+L+ALDE Sbjct: 122 PPSVRREEHSVEDWAHDLLEYVGIGKYAHFTSRNLSYGHQRRLEIARALATEPKLLALDE 181 Query: 184 PAAGMNATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAE 243 PAAGMNATEKV+LR L+D+IR+D +TILLIEHDVKLVMGLC+R+TVLDYGK IA+G P E Sbjct: 182 PAAGMNATEKVELRGLLDKIRSDGKTILLIEHDVKLVMGLCNRLTVLDYGKVIAQGLPHE 241 Query: 244 VQKNEKVIEAYLGTGGH 260 VQ N VIEAYLGT H Sbjct: 242 VQSNPAVIEAYLGTPAH 258 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 258 Length adjustment: 24 Effective length of query: 236 Effective length of database: 234 Effective search space: 55224 Effective search space used: 55224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory