Align Branched chain amino acid ABC transporter substrate-binding protein (characterized, see rationale)
to candidate RR42_RS00190 RR42_RS00190 ABC transporter substrate-binding protein
Query= uniprot:A0A165KTD4 (375 letters) >FitnessBrowser__Cup4G11:RR42_RS00190 Length = 393 Score = 140 bits (353), Expect = 6e-38 Identities = 115/383 (30%), Positives = 177/383 (46%), Gaps = 21/383 (5%) Query: 1 MQLKLKLTVVAA--IAAAAGVA-----SAQEQVVKIGHVAPVSGAQAHYGKDNENGARMA 53 M+++ K TVVAA + A+AG+A +A + VVKI V P++G + G N A +A Sbjct: 1 MRVRKKNTVVAAALLLASAGLAGMSAPAAAKDVVKIAFVGPLTGGVSSIGLGGRNSADLA 60 Query: 54 IEELNAQGVTIGGKKIKFELVAEDDAADPKQGTAAAQKLC-DAKVAGVVGHLNSGTTIPA 112 + NA + K +ELV +DD P G A K+ D + V H S + Sbjct: 61 VRLRNADPKS----KYTYELVTQDDECRPNVGVQVATKIAADKSIVAGVTHFCSAVAMGT 116 Query: 113 SKVYNDCGIPHVTGAATNPNLTKPGYKTTFRIIANDNAL---GAGLAFYAVDTLKLKTVA 169 VYN G+P V A P++T Y F+ I N + +A + L K A Sbjct: 117 VGVYNRFGMPAVVWGAVLPDVT---YGNNFKEIHRVNGTMINQSEVAAKFMTGLGYKKWA 173 Query: 170 IIDDRTAYGQGVADVFKKTATAKGMKVVDEQFTTDKATDFMAILTAIKAKNPDAIFYGGM 229 II D T YG+G F + G V+ T DF LT I+ PD +++GG+ Sbjct: 174 IIHDTTDYGKGHNKYFSEFLKKDGGTVLGTFGVTADQQDFTTELTKIRELKPDVVYFGGL 233 Query: 230 DPQGGPMLRQMEQLGMGNVKYFGGDGICTSEIAKLAAGAKTLGNVICAEGGSSLAKMPGG 289 P G + QME+LG+ ++ G GI + + + G++ E G+ K+PGG Sbjct: 234 TPLGVRIRTQMEKLGI-KAQFEGTSGIKSDAYIQGTGKEQAEGSLAFIE-GAPWEKLPGG 291 Query: 290 TAWKAKY-DAKYPNQFQVYSPYTYDATFLIVDAMKRANSVDPKVYTPELAKSSFKGVTST 348 + KY KY + + Y P+ + A LI+DA+++ KV A + Sbjct: 292 LFFAGKYSQQKYSDPPEAYGPFAFAAAKLIMDAVEKVGPDRKKVRDTLNATKDADTIIGK 351 Query: 349 IAFEPNGEMKNPAITLYVYKDGK 371 + F+ + + P +T YV +DGK Sbjct: 352 VTFDDHRQNIVPLVTKYVVEDGK 374 Lambda K H 0.315 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 393 Length adjustment: 30 Effective length of query: 345 Effective length of database: 363 Effective search space: 125235 Effective search space used: 125235 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory