Align acyl-CoA oxidase (EC 1.3.3.6) (characterized)
to candidate RR42_RS28565 RR42_RS28565 acyl-CoA dehydrogenase
Query= BRENDA::Q96329 (436 letters) >FitnessBrowser__Cup4G11:RR42_RS28565 Length = 377 Score = 163 bits (412), Expect = 1e-44 Identities = 111/369 (30%), Positives = 172/369 (46%), Gaps = 7/369 (1%) Query: 58 EEQAIRKKVRECMEKEVAPIMTEYWEKAEFPFHITPKLGAMGVAGGSI-KGYGCPGLSIT 116 ++ IR R + +AP E+ + P + ++GA+G+ G + + +G Sbjct: 8 QQTMIRDTARTFASERLAPCAAEWDRAGQLPAEVVAEMGALGLLGMIVPEEWGGTYTDYI 67 Query: 117 ANAIATAEIARVDASCSTFILVHSSLGMLTIALCGSEAQKEKYLPSLAQLNTVACWALTE 176 A A+A EIA A+C+T + VH+S+G I G++AQKE+YLP LA + + LTE Sbjct: 68 AYALAIEEIAAGCAACATLMSVHNSVGCGPILHYGTQAQKERYLPRLASGEIIGAFCLTE 127 Query: 177 PDNGSDASGLGTTATKVEGGWKINGQKRWIGNSTFADLLIIFARNTTT---NQINGFIVK 233 P GS+A L T A + GW ++G K+++ N A + I+FA ++ F+V Sbjct: 128 PQAGSEAHNLRTRARATDNGWVLSGSKQFVTNGQRAGVAIVFAATEPAQGKRGLSAFVVP 187 Query: 234 KDAPGLKATKIPNKIGLRMVQNGDILLQNVFVPDEDRL--PGVNSFQDTSKVLAVSRVMV 291 D PG K+G+R I L + VP + L PG + L R+ + Sbjct: 188 TDTPGFSVHTPERKMGIRASDTCAITLDDCQVPHDALLGEPG-EGLRIALSNLEGGRIGI 246 Query: 292 AWQPIGISMGIYDMCHRYLKERKQFGAPLAAFQLNQQKLVQMLGNVQAMFLMGWRLCKLY 351 A Q +GI+ ++ RY ER QFG PL L M + A L+ R + Sbjct: 247 AAQALGIARSAFEAACRYAAERVQFGRPLREHAPIANMLADMATELNAARLLVHRAAHMR 306 Query: 352 ETGQMTPGQASLGKAWISSKARETASLGRELLGGNGILADFLVAKAFCDLEPIYTYEGTY 411 GQ +AS K + S A S ++ GG G L D+ V + + D YEGT Sbjct: 307 TAGQPCLSEASQAKLYASELAERVCSKALQIHGGYGYLEDYPVERHYRDARITQIYEGTS 366 Query: 412 DINTLVTGR 420 +I ++ R Sbjct: 367 EIQRMLIAR 375 Lambda K H 0.319 0.133 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 377 Length adjustment: 31 Effective length of query: 405 Effective length of database: 346 Effective search space: 140130 Effective search space used: 140130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory