Align L-arabinose 1-dehydrogenase; D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate RR42_RS30145 RR42_RS30145 3-oxoacyl-ACP reductase
Query= reanno::acidovorax_3H11:Ac3H11_614 (280 letters) >FitnessBrowser__Cup4G11:RR42_RS30145 Length = 255 Score = 209 bits (533), Expect = 4e-59 Identities = 111/251 (44%), Positives = 149/251 (59%), Gaps = 2/251 (0%) Query: 29 AKFPSLQGRAVFVTGGGSGIGAAIVAAFAEQGARVAFVDVAREASEALAQHIADAGLPRP 88 A +PSL+ ++V +TGGG GIGA +V AFA QGA V F+DV + L + GL Sbjct: 4 AIYPSLKEKSVVITGGGGGIGAEMVGAFARQGAHVHFIDVCEVGARQLQDALTAEGL-HT 62 Query: 89 WWRVCDVRDVQALQACMADAAAELGSDFAVLVNNVASDDRHTLESVTPEYYDERMAINER 148 + CD+RD+ A A D A+ VLVNN DDRH +++VTP ++E +A+N R Sbjct: 63 VFHPCDLRDIGATTAVF-DRIAQACGPIGVLVNNAGRDDRHQVDAVTPSDWEECIAVNLR 121 Query: 149 PAFFAIQAVVPGMRRLGAGSVINLGSTGWQGKGTGYPCYAIAKSSVNGLTRGLAKTLGQD 208 FF Q GMR G ++NLGS W Y AK+ + GLTRGLA+ LG+D Sbjct: 122 HQFFCAQLAAAGMRTARTGVILNLGSASWHVAVPDLSIYMTAKAGIEGLTRGLARDLGRD 181 Query: 209 RIRINTVSPGWVMTERQIKLWLDAEGEKELARNQCLPDKLRPHDIARMVLFLASDDAAMC 268 IR+N + PG V T RQ LW A+ E L ++QCLP ++ P +A M LFLASDDA C Sbjct: 182 GIRVNCIVPGAVRTPRQTLLWQTAQSEARLLQSQCLPARIEPRHVAAMALFLASDDAERC 241 Query: 269 TAQEFKVDAGW 279 + +E+ VDAG+ Sbjct: 242 SGREYFVDAGY 252 Lambda K H 0.320 0.133 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 255 Length adjustment: 25 Effective length of query: 255 Effective length of database: 230 Effective search space: 58650 Effective search space used: 58650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory