Align LacK, component of Lactose porter (characterized)
to candidate RR42_RS12955 RR42_RS12955 glycerol-3-phosphate ABC transporter ATP-binding protein
Query= TCDB::Q01937 (363 letters) >FitnessBrowser__Cup4G11:RR42_RS12955 Length = 367 Score = 343 bits (880), Expect = 4e-99 Identities = 187/370 (50%), Positives = 254/370 (68%), Gaps = 13/370 (3%) Query: 1 MAEVRLTDIRKSY-GSLEVIKGVNLEVSSGEFVVFVGPSGCGKSTLLRMIAGLEDISSGE 59 MA++ L +++K+Y G+++V+ G+++E++ GEF+V VGPSGCGKSTLLRM+AGLE IS GE Sbjct: 1 MAKLSLRNVQKTYAGNVKVVHGIDMEINDGEFIVIVGPSGCGKSTLLRMVAGLEAISGGE 60 Query: 60 LTIGGTVMNDVDPSKRGIAMVFQTYALYPHMTVRENMGFALRFAGMAKDEIERRVNAAAK 119 + IG V+N ++P++R IAMVFQ YALYPHM+V +NM + L+ GM K EIE+RV AA Sbjct: 61 VHIGDKVVNHLEPAERDIAMVFQNYALYPHMSVYDNMAYGLKIRGMDKSEIEQRVKHAAG 120 Query: 120 ILELDALMDRKPKALSGGQRQRVAIGRAIVRQPDVFLFDEPLSNLDAELRVHMRVEIARL 179 ILEL L++RKP+ALSGGQRQRVA+GRAIVR+P VFLFDEPLSNLDA+LRV MR+E+ L Sbjct: 121 ILELAPLLERKPRALSGGQRQRVAMGRAIVREPAVFLFDEPLSNLDAKLRVQMRLELKEL 180 Query: 180 HKELNATIVYVTHDQVEAMTLADKIVVMRGGIVEQVGAPLALYDDPDNMFVAGFIGSPRM 239 H+ L T +YVTHDQVEAMTLAD+++V+ GG VEQ+G PL +Y P + FVA FIGSP M Sbjct: 181 HRRLRTTSMYVTHDQVEAMTLADRMMVLNGGSVEQIGTPLEVYARPASTFVASFIGSPPM 240 Query: 240 NFLPAVVIGQAEGGQVTVALKARPDTQLTVACAT---PPQG---GDAVTVGVRPEHFLPA 293 N +P + + GGQ ++ A AT P G + +G+RPEH P Sbjct: 241 NLVP---VTRTNGGQGEAQMRVEQKPGAQGAPATLGHLPMGLHLPERALLGLRPEHIEPC 297 Query: 294 GSGDTQLTAHVDVVEHLGNTSYVYAHTVPGEQIIIEQEERRHGGRYGDEIAVGISAKTSF 353 + + V +VE LG SY Y T+ G+ +++ + GD + + +A+ Sbjct: 298 AAHEAIAEIEVRLVEALGADSYAYG-TLGGQPVVVRLDSNMPVSS-GDRLPITAAAEHLH 355 Query: 354 LFDA-SGRRI 362 FDA SG+RI Sbjct: 356 FFDADSGKRI 365 Lambda K H 0.320 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 367 Length adjustment: 30 Effective length of query: 333 Effective length of database: 337 Effective search space: 112221 Effective search space used: 112221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory