GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aacS in Cupriavidus basilensis 4G11

Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate RR42_RS31975 RR42_RS31975 fatty acid--CoA ligase

Query= reanno::acidovorax_3H11:Ac3H11_3009
         (578 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS31975 RR42_RS31975 fatty
           acid--CoA ligase
          Length = 546

 Score =  292 bits (748), Expect = 2e-83
 Identities = 188/542 (34%), Positives = 279/542 (51%), Gaps = 23/542 (4%)

Query: 27  IEQTIGAFFADMVARQPERE-ALVSVHQ-GRRYTYAQLQTEAHRLASALLGMGLTPGDRV 84
           I  TI A   ++V     R  A +++ + G R ++ +L T   +   ALL +GL PGDRV
Sbjct: 23  IPATIPATIPELVRTAAARHGARIAIQEDGLRLSFTELDTLRAQAGRALLALGLLPGDRV 82

Query: 85  GIWSHNNAEWVLMQLATAQVGLVLVNINPAYRTAEVEYALNKVGCKLLVSMARFKTSDYL 144
            +W+ N +EW++  LA   +G  LV IN   +  E    L   G ++L  +  F    Y 
Sbjct: 83  AVWAPNLSEWIVAALAAHSIGAALVPINTRMKGMEAGAILADSGARVLFCIDNFLGESYP 142

Query: 145 GMLRELAPEWQGQQPGHLQAAKLPQLKTVVWIDDEAGQ--GADEPGLLRFTELIARGNAA 202
            ML   AP     +PG L+         +V +   AG+    DE     F  L A+   A
Sbjct: 143 EML---APH----RPGTLER--------IVVLRGRAGRQMAPDELAWADFLALAAQTGEA 187

Query: 203 DPRLAQVAAGLQATDPINIQFTSGTTGFPKGATLTHRNILNNGFFIGECMKLTPADRLCI 262
             R  + A  +     ++I FTSGTTG PKG    H   L           +   DR  I
Sbjct: 188 AFRACESA--VSGDTLMDIMFTSGTTGRPKGVMTAHAQNLQAIHGWASITGVEAGDRYLI 245

Query: 263 PVPLYHCFGMVLGNLACFTHGATIVYPNDGFDPLTVLQTVQDERCTGLHGVPTMFIAELD 322
             P +H FG   G LA    GATI+ P+  FD   V+  +++ER T L G PT++   L+
Sbjct: 246 VNPFFHTFGYKAGWLAALASGATIL-PHLVFDAEAVMTRIENERITVLPGPPTLYQTLLN 304

Query: 323 HPRFAEFNLSTLRTGIMAGSPCPTEVMKRVVEQMNLREITIAYGMTETSPVSCQSSTDTP 382
           HPR  EF+LS+LR  +   S  P  +++R+  ++  R+I   YG+TE+   +  +     
Sbjct: 305 HPRLREFDLSSLRVAVTGASAIPPVLIQRMRRELGFRDIFTGYGLTESCGFATLTRAADD 364

Query: 383 LSKRVSTVGQVQPHLEVKIVDPDTGAVVPIGQRGEFCTKGYSVMHGYWGDEAKTREAIDE 442
                 T G+  P +E++ VD   G  VP G+ GE   +GY+VM GY+     T EAID 
Sbjct: 365 ADIVALTSGRAMPGVELRCVD-GAGYPVPAGEPGEVTVRGYNVMRGYFQLPEATTEAIDA 423

Query: 443 GGWMHTGDLATMDAEGYVNIVGRIKDMVIRGGENIYPREIEEFLYRHPQVQDVQVVGVPD 502
           GGW+ TGD+ T+D  G + I  RIKDM I GG N YP EIE+ L  HP +  V VVGVP 
Sbjct: 424 GGWLRTGDIGTLDVRGNLRITDRIKDMFIVGGFNCYPAEIEKLLVSHPAIAQVAVVGVPH 483

Query: 503 QKYGEELCAWIIAKPGTQPTEDDIRAFCKGQIAHYKVPRYIRFVTSFPMTVTGKIQKFKI 562
           ++ GE   A+++ + G++   D++  + +  +A+YKVPR + FV + P +  GKI K+++
Sbjct: 484 ERLGEAGKAFVVLRHGSKVGADELIDWARRHMANYKVPREVVFVQTLPTSAAGKILKYRL 543

Query: 563 RD 564
           R+
Sbjct: 544 RE 545


Lambda     K      H
   0.320    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 738
Number of extensions: 34
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 578
Length of database: 546
Length adjustment: 36
Effective length of query: 542
Effective length of database: 510
Effective search space:   276420
Effective search space used:   276420
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory