Align Dihydrolipoyllysine-residue acyltransferase component of branched-chain alpha-ketoacid dehydrogenase complex; Branched-chain alpha-ketoacid dehydrogenase complex component E2; BCKADH E2; Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase; EC 2.3.1.168 (characterized)
to candidate RR42_RS33055 RR42_RS33055 branched-chain alpha-keto acid dehydrogenase subunit E2
Query= SwissProt::O06159 (393 letters) >FitnessBrowser__Cup4G11:RR42_RS33055 Length = 367 Score = 184 bits (466), Expect = 5e-51 Identities = 135/374 (36%), Positives = 182/374 (48%), Gaps = 22/374 (5%) Query: 7 IRSFPVPDLGEGLQEVTVTCWSVAVGDDVEINQTLCSVETAKAEVEIPSPYAGRIVELGG 66 ++ F +PDLGEGLQE +T W V GD V +Q L SVETAKA VEIPSPYAG++ +L Sbjct: 1 MKIFKLPDLGEGLQEAEITEWHVKPGDTVAADQPLVSVETAKAIVEIPSPYAGQVAKLFA 60 Query: 67 AEGDVLKVGAELVRIDTGPTAVAQPNGEGAVPTLVGYGADTAIETSRRTSRP----LAAP 122 G+++ +GA L G GAV V G E SR A P Sbjct: 61 QPGEIVHLGAPLA----GFEGAGGQEDAGAVVGDVKVGTQVVAEAPAALSRGGGAVRAVP 116 Query: 123 VVRKLAKELAVDLAALQRGSGAGGVITRADVLAAARGGVGAGPDVRPVHGVHARMAEKMT 182 VR LA++L VDLA + +GA G+I+ ADV A GP + GV MA M Sbjct: 117 AVRALARQLDVDLAMVTP-TGADGIISAADVRRVAATLADLGPP-EVLRGVRRAMALNM- 173 Query: 183 LSHKEIPTAKASVEVICAELLRLRDRFVSAAPEITPFALTLRLLVIALKHNVILNSTWVD 242 A+A EV A ++ D A T L +R LV + LN+ W + Sbjct: 174 --------ARAQSEVAAATVIDDADIHAWAPGTDTTIRL-VRALVAGCRAEPGLNA-WYE 223 Query: 243 SGEGPQVHVHRGVHLGFGAATERGLLVPVVTDAQDKNTRELASRVAELITGAREGTLTPA 302 S G + HV + +G GL VPV+ D ++ +L + + R T+ P Sbjct: 224 SQTGRR-HVPARIDVGIAVDLPEGLFVPVLRDTGKRDAADLRRGLDRMRADVRARTIAPE 282 Query: 303 ELRGSTFTVSNFGALGVDDGVPVINHPEAAILGLGAIKPRPVVVGGEVVARPTMTLTCVF 362 E+RG+T T+SNFG + P++ P AILG G I V GG V + L+ F Sbjct: 283 EMRGNTITLSNFGMIAGKYAAPIVVPPTVAILGAGRIHDAVVAAGGMPVVHRILPLSLTF 342 Query: 363 DHRVVDGAQVAQFM 376 DHRVV G + A+F+ Sbjct: 343 DHRVVTGGEAARFL 356 Lambda K H 0.317 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 421 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 367 Length adjustment: 30 Effective length of query: 363 Effective length of database: 337 Effective search space: 122331 Effective search space used: 122331 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory