Align 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic; 3-hydroxy-3-methylglutaryl-CoA lyase-like protein 1; EC 4.1.3.4 (characterized)
to candidate RR42_RS12425 RR42_RS12425 3-hydroxy-3-methylglutaryl-CoA lyase
Query= SwissProt::D4A5C3 (343 letters) >FitnessBrowser__Cup4G11:RR42_RS12425 Length = 326 Score = 188 bits (478), Expect = 1e-52 Identities = 112/319 (35%), Positives = 170/319 (53%), Gaps = 16/319 (5%) Query: 39 SQLSGLPEYVKIVEVGPRDGLQNEKVIVPTDIKIEFINQLSQTGLSVIEVTSFVSSRWVP 98 + + P I EVG RDGLQ+ I+PT K E+I G IEV SFV ++ +P Sbjct: 3 THIPSAPRQAVIREVGLRDGLQSIATILPTSAKREWIQAAYAAGQREIEVGSFVPAKLLP 62 Query: 99 QMADHAEVMGGIHQYPGVRYPVLVPNLQGLQHAVAAGATEIAVFGAASESFSKKNINCSI 158 Q+AD AE++ PG+ VLVPNL+G Q+A+A+GA + V +AS + S N+ + Sbjct: 63 QLADTAELVDFARSLPGLFVSVLVPNLRGAQNAIASGADLMLVPLSASHAHSLANLRKTP 122 Query: 159 EESMGRFEQVISS--ARHMNIPVRGYVSCALGCPYEGSIMPQKVTEVSKRLYSMGCYEIS 216 +E + ++ + A + G V A GC +G + P++V + + L G +S Sbjct: 123 DEVVAEVARIRAERDAAGSRTLIEGGVGTAFGCTIQGHVDPEEVLRLMQALLDAGADRVS 182 Query: 217 LGDTVGVGTPGSMKTMLESVMKEIPPGALAVHCHDTYGQALANILTALQMGINVVDSAVS 276 L DTVG PG ++ + E H HDT G LAN+ AL+ G+ D+ ++ Sbjct: 183 LADTVGYADPGMVRRLFERATALAGDRFWCGHFHDTRGLGLANVHAALEAGVTRFDACLA 242 Query: 277 GLGGCPYAKGASGNVATEDLIYMLNGMGLNTGVDLHKVMEAGDFIC-------------- 322 G+GGCP+A GASGNVATEDL Y+L MG +TG+D+ +++ + + Sbjct: 243 GIGGCPHAPGASGNVATEDLAYLLGSMGFDTGIDIGRLLALRERVAGWLTNETLHGTLWR 302 Query: 323 KAVNKTTNSKVAQASFKAR 341 + KT + VA A+F+ R Sbjct: 303 AGLPKTFPASVADAAFRLR 321 Lambda K H 0.316 0.132 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 326 Length adjustment: 28 Effective length of query: 315 Effective length of database: 298 Effective search space: 93870 Effective search space used: 93870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory