Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate RR42_RS25035 RR42_RS25035 ABC transporter permease
Query= TCDB::Q8DQI0 (292 letters) >FitnessBrowser__Cup4G11:RR42_RS25035 Length = 297 Score = 195 bits (496), Expect = 9e-55 Identities = 97/287 (33%), Positives = 179/287 (62%), Gaps = 3/287 (1%) Query: 3 LMLQQLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDIYMMGAFIGYFLINSFQMNFF 62 +++QQL+NGL++GS YA+ ALG+T+++G+ ++N A+G ++M G+F G + F+ FF Sbjct: 1 MLIQQLLNGLVMGSTYAVFALGFTLLFGVNHIMNMAYGSLFMWGSFAGLYAATLFKAPFF 60 Query: 63 VALIVAMLATAILGVVIEFLAYRPLR--HSTRIAVLITAIGVSFLLEYGMVYLVGANTRA 120 V+++V MLA +L + ++ +A+RPLR H+ + ++ +IG S ++ + + Sbjct: 61 VSMLVGMLAGGVLSIALDLVAFRPLRRRHAPDFSYILASIGASLVMLALAQKVSNTSVMQ 120 Query: 121 FPQA-IQTVRYDLGPISLTNVQLMILGISLILMILLQVIVQKTKMGKAMRAVSVDSDAAQ 179 FP+ V Y+ + + +Q++I+G ++++ L + T MG+ +R V+ A+ Sbjct: 121 FPEGTFPIVVYEFLGLQIQLLQIIIVGAGMVIVAGLVYALYGTGMGRRIRCVAYSEATAR 180 Query: 180 LMGINVNRTISFTFALGSALAGAAGVLIALYYNSLEPLMGVTPGLKSFVAAVLGGIGIIP 239 L+GIN + F + ALAG AGVLI + +NS+ +MG + +++FV ++GG+G IP Sbjct: 181 LLGINAEWVNAQVFFISGALAGLAGVLIGVAFNSIHFMMGESFLMRAFVVIIVGGLGSIP 240 Query: 240 GAALGGFVIGLLETFATAFGMSDFRDAIVYGILLLILIVRPAGILGK 286 GA GG +IG++++ A A+ S D I + +L LI+++RP G+ G+ Sbjct: 241 GALAGGILIGVVQSLAYAYISSAAADGIAFVVLFLIILIRPTGLFGQ 287 Lambda K H 0.330 0.146 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 297 Length adjustment: 26 Effective length of query: 266 Effective length of database: 271 Effective search space: 72086 Effective search space used: 72086 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory