Align pipecolate oxidase (EC 1.5.3.7) (characterized)
to candidate RR42_RS07820 RR42_RS07820 hypothetical protein
Query= metacyc::G1G01-5614-MONOMER (432 letters) >FitnessBrowser__Cup4G11:RR42_RS07820 Length = 431 Score = 202 bits (514), Expect = 2e-56 Identities = 124/390 (31%), Positives = 192/390 (49%) Query: 13 LWEHVSKPTVAAQALAGEHKADVCVIGGGITGLSAAIHLLEQGKSVIVLEAWKIGHGGSG 72 LW + P A++A+ G + DV ++GGG TGLSAA+HL + G + EA++IGH SG Sbjct: 12 LWAATALPRTASEAVRGPLQVDVAIVGGGFTGLSAALHLAQAGVHTALFEAFEIGHRASG 71 Query: 73 RNVGLVNAGTWIRPDDVEATLGQKQGSRLNKVLGEAPAEVFAMIERLGIDCQAQHKGTLH 132 RN G V G P + G R+ ++ + E+FA++ER I CQ G L Sbjct: 72 RNGGQVVPGVKPPPSALTKRFGDDTARRMMRLAYGSADELFALVERYQIRCQPTRNGWLQ 131 Query: 133 MAHNATGIADLEARHEQWRRRGADVELLTGAQCQEYCGTDKISAALLDRRAGTINPMGYT 192 A++ L R + +G + L + + G+D + LL++ AG + P+ Y Sbjct: 132 GAYSQASSGYLRQRSHEINGQGGNTTYLDRDEMRAATGSDYWPSGLLEKSAGAVQPLAYA 191 Query: 193 QGLAAAVTRLGGKIFQQSSVEGLEREGDGWRVKTARGAVRAEKVVISTGAYTEGDWSNLQ 252 +GLA AVT LGG + + S V+ + ++++ AV+A KV+++T AYT+ + Sbjct: 192 RGLARAVTDLGGTLHEYSPVQSISTSAGRFKLQVNGHAVQARKVILATDAYTDRLVPEVA 251 Query: 253 KQFFRGYYYQVASKPLQGIAADKVLPHGQGSWDTRTVLSSIRRDDQGRLLLGSLGRVDNK 312 + + Q+A+ PL ++LP G +TR + R D +GR ++G GR + Sbjct: 252 QSYVNVSSAQIATDPLPPELQQRLLPLRAGISETRKITYYCRLDPEGRFVIGGRGRDSDN 311 Query: 313 PAWFVRSWADRIQSHYYPELGKVEWEMHWTGCIDFTPDHLMRLFEPAPGLVAVTGYNGRG 372 R +PEL V + W + T D L L E A GL A GY GRG Sbjct: 312 LDPATREQLRLAACQRFPELNDVVFTHGWACRVGMTIDDLPHLHELADGLWAAYGYCGRG 371 Query: 373 NTTGTVIGRAFAEFLLKGEADSLPIPFSPM 402 GTV+GR E + A +L P +P+ Sbjct: 372 VAMGTVLGRVLGEAVRGMPAAALDYPVTPV 401 Lambda K H 0.319 0.135 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 431 Length adjustment: 32 Effective length of query: 400 Effective length of database: 399 Effective search space: 159600 Effective search space used: 159600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory