Align Putative amino-acid binding periplasmic protein (characterized, see rationale)
to candidate RR42_RS04395 RR42_RS04395 cysteine ABC transporter substrate-binding protein
Query= uniprot:Q92PA9 (260 letters) >FitnessBrowser__Cup4G11:RR42_RS04395 Length = 265 Score = 134 bits (338), Expect = 1e-36 Identities = 86/255 (33%), Positives = 140/255 (54%), Gaps = 16/255 (6%) Query: 7 LAATASAAVFVLMAGVAMAEGEKVVIGTEGAYPPFNNLESDGTLTGFDIDIAKALCEEMK 66 LAA A+A L+ V A K IG EG YPPFN S+ L GFD+D+AK + ++ Sbjct: 18 LAAGAAAQAADLLDTVKQAGVLK--IGLEGTYPPFNYRGSNNQLEGFDVDVAKGVAAKLG 75 Query: 67 AECTFVTQDWDGIIPALIAKKFDAIVASMSITEERKQQVDFTNKYYNTPPAIVVPKDSPI 126 + FVT +W GII L A KFD IV +++T +RKQ +DF+ Y + ++ KD Sbjct: 76 VKPEFVTTEWSGIIAGLQAGKFDVIVNQVAVTPQRKQVLDFSTPYVYSAAQLIQRKDDNR 135 Query: 127 TEATAAALSGKALGAQGSTTHSNYAEAHMKESEVKLYPTADEYKLDLANGRIDAAIDDVV 186 + L GK LG + ++ A++ + +VK YP A EY DLA R+DAA++D + Sbjct: 136 QFKSLEDLKGKKLGVSLGSNYNELAKS-VAGIDVKTYPGAPEYLRDLAAQRVDAALNDRL 194 Query: 187 VLSEWLKTEDGACCKLLGTLPIDP--VINGEGAGIAI--RKGDDALREKLNKAIEAIRAN 242 ++ +KT + LP+ P ++ G + +AI RK + + +++A++ +R + Sbjct: 195 MIGYLIKTSN---------LPLRPGAIVEGGNSEVAIPFRKDNPKFAQAIDRALDEMRKD 245 Query: 243 GKYKQINEKYFPFDV 257 G +++ ++F DV Sbjct: 246 GSLGKLSARWFGSDV 260 Lambda K H 0.315 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 265 Length adjustment: 25 Effective length of query: 235 Effective length of database: 240 Effective search space: 56400 Effective search space used: 56400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory