Align butyryl-CoA dehydrogenase; EC 1.3.99.2 (characterized)
to candidate RR42_RS00870 RR42_RS00870 isovaleryl-CoA dehydrogenase
Query= CharProtDB::CH_091785 (379 letters) >FitnessBrowser__Cup4G11:RR42_RS00870 Length = 396 Score = 297 bits (761), Expect = 3e-85 Identities = 157/383 (40%), Positives = 244/383 (63%), Gaps = 5/383 (1%) Query: 1 MDFNLTREQELVRQMVREFAENEVKPIAAEIDETERFPMENVKKMGQYGMMGIPFSKEYG 60 + F+L + E++R+ V +A+ E+ P AAEID T++FPM+ KKMG G++GI ++EYG Sbjct: 10 LKFDLGEDIEMLRETVCNWAQAELAPRAAEIDRTDQFPMDAWKKMGDLGVLGITVAEEYG 69 Query: 61 GAGGDVLSYIIAVEELSKVCGTTGVILSAHTSLCASLINEHGTEEQKQKYLVPLAKGEKI 120 GA L+++IA+EE+S+ + G+ AH++LC + I+ +GT QK +YL L G+ I Sbjct: 70 GANMGYLAHMIAMEEISRASASVGLSYGAHSNLCVNQIHRNGTAAQKARYLPKLVSGDWI 129 Query: 121 GAYGLTEPNAGTDSGAQQTVAVLEGDHYVINGSKIFITNGGVADTFVIFAMTDRTKGTKG 180 GA ++EPNAG+D + + A +GDHYV+NG+K++ITNG D V++A T+ G +G Sbjct: 130 GALAMSEPNAGSDVVSMKLRADFKGDHYVLNGTKMWITNGPDCDVLVVYAKTEPDLGARG 189 Query: 181 ISAFIIEKGFKGFSIGKVEQKLGIRASSTTELVFEDMIVPVENMIGKEGKGFPIAMKTLD 240 ++AFI+EKG KGFS+ + KLG+R S T ELVF+D+ VPVEN++G E G + M LD Sbjct: 190 MTAFIVEKGMKGFSVAQKLDKLGMRGSHTGELVFQDVEVPVENILGGENLGAKVLMSGLD 249 Query: 241 GGRIGIAAQALGIAEGAFNEARAYMKERKQFGRSLDKFQGLAWMMADMDVAIESAR-YLV 299 R ++ +GI + + Y+ +RKQFG+S+ +FQ + +ADM +++AR YL Sbjct: 250 YERAVLSGGPVGIMQACMDVITPYIHDRKQFGQSIGEFQLIQGKVADMYTTLQAARSYLY 309 Query: 300 YKAAYLKQAGLPYT----VDAARAKLHAANVAMDVTTKAVQLFGGYGYTKDYPVERMMRD 355 L G + D A L+ A A + ++VQ+ GG GY +YPV R+ RD Sbjct: 310 TVGKNLDSLGKDHVRQVRKDCAAVILYTAEKATWMAGESVQILGGNGYINEYPVGRLWRD 369 Query: 356 AKITEIYEGTSEVQKLVISGKIF 378 AK+ EI GTSE+++++I ++F Sbjct: 370 AKLYEIGAGTSEIRRMLIGRELF 392 Lambda K H 0.317 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 379 Length of database: 396 Length adjustment: 30 Effective length of query: 349 Effective length of database: 366 Effective search space: 127734 Effective search space used: 127734 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory