Align 1-piperideine-2-carboxylate/1-pyrroline-2-carboxylate reductase (NADPH) (EC 1.5.1.21) (characterized)
to candidate RR42_RS11115 RR42_RS11115 ornithine cyclodeaminase
Query= BRENDA::F1RPC8 (314 letters) >FitnessBrowser__Cup4G11:RR42_RS11115 Length = 323 Score = 119 bits (297), Expect = 1e-31 Identities = 96/301 (31%), Positives = 147/301 (48%), Gaps = 14/301 (4%) Query: 15 DHLRSSSLLIPP--LEAALANFS--SGPDGGVVQPVRTVVPVAKHSGFLGVMPAYSAAED 70 D + SLL P +EA F+ S +G V VR P+A G G+ ++ Sbjct: 11 DKNQVESLLQPADAMEAVSEAFALHSEGEGRVFPLVRE--PLAT-GGVFGIKSGDVQSQG 67 Query: 71 ALTTKLVTFYEGHRSTSTVPSHQATVLLFEPSNGSLLAVMDGNVITAKRTAAVSAIATKF 130 L K F+ +R P HQAT++L +P+ G + ++DGN +T RT A + ++ Sbjct: 68 LLGFKAAGFWPANREVGGEP-HQATIMLIDPATGRPVCMIDGNAVTTMRTGAAGGLGLQW 126 Query: 131 LKPPNSEVLCILGAGVQAYSHYEVFTEQF-SFKEVRIWNRTKENAEKF--ANTVQGEVEV 187 L +SE LC+ G GVQA S K+V+ T ++ F A + E+ Sbjct: 127 LARQDSERLCLFGTGVQARIQLTFALALLPSLKQVQYVTVTGQHDAAFERAFAERCEISH 186 Query: 188 CPSVQEAVAGADVIITVTMATEPILFGEWVKPGAHINAIGASRPDWRELDDELMKQAVLY 247 P AVAG+DV+IT T + + V+PG H+N +GA REL D L+ +A L+ Sbjct: 187 APDRNAAVAGSDVVITATPGGGALFDLQAVQPGTHLNCVGADTRGKRELPDGLLARARLF 246 Query: 248 VDSREAAVKESGDVLLSGAEIFAELGEVVKGVKPA--HCEKTTVFKSLGMAVEDLVAAKL 305 VD R A ++ G+ + E+G+V+ G H TVF G+A++DL A+L Sbjct: 247 VDDR-AQARQIGETQWAPDTPCTEIGDVLGGKVQVERHDTDITVFDMTGLALQDLTVARL 305 Query: 306 V 306 + Sbjct: 306 L 306 Lambda K H 0.315 0.130 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 323 Length adjustment: 27 Effective length of query: 287 Effective length of database: 296 Effective search space: 84952 Effective search space used: 84952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory