Align Delta(1)-pyrroline-2-carboxylate/Delta(1)-piperideine-2-carboxylate reductase; Pyr2C/Pip2C reductase; EC 1.5.1.1 (characterized)
to candidate RR42_RS20320 RR42_RS20320 ornithine cyclodeaminase
Query= SwissProt::V5YW53 (311 letters) >FitnessBrowser__Cup4G11:RR42_RS20320 Length = 319 Score = 174 bits (440), Expect = 3e-48 Identities = 121/314 (38%), Positives = 163/314 (51%), Gaps = 27/314 (8%) Query: 7 IPVFDAADTAALLAYPALLATLGQAVADYAAGEIVSPERLVVPL--QAGG--VMLSMPSS 62 + + DAA TAA L YPAL + +A+ AG ++P R+ +P+ AGG +L MP+ Sbjct: 3 VALLDAAQTAARLPYPALARAIAAMLAELRAGTAMAPPRIALPVGDPAGGEGTLLVMPAR 62 Query: 63 ARDLATHKLVNVCPGNGARGLPTILGQVTAYDASTGEMRFALDGPTVTGRRTAAVTALGI 122 R+L K + V PGN RGLP ILG+V DA TG LDGPTVTGRRTAAV+ L Sbjct: 63 NRELVMTKNITVHPGNPQRGLPNILGEVVVADAHTGRRLALLDGPTVTGRRTAAVSLLAA 122 Query: 123 QALHGAAPRDILLIGTGKQAANHAEALAAIFPEARLHVRGTSADSAAAFCAAHRAQAPRL 182 Q+ ++L+IG G QA H EA AA R+ + +A A A A R Sbjct: 123 QSFAPDPAGELLIIGAGVQALTHLEAFAAGLSPRRVWLHSRTAAKAEALAAHARTLGVEA 182 Query: 183 VPLDG-DAIPDAIDVVVTLTTSRTPVYREAA----REGRLVVGVGAFTADAAEIDANTVR 237 +D + + +VVT+T+S PV + R+ + VGAF + E+ + Sbjct: 183 QSVDDVRTVLPRVSMVVTVTSSLVPVLPDLDSGLWRDDHFIAAVGAFRPEMCELPPALCQ 242 Query: 238 AS----RLVVDDPAGARHEAGDLIVAQVDWQHV-----ASLAD----VLGGTFDRSGPLL 284 A+ RL+ D G EAGDL+ A + W V A LA+ GG+ PL+ Sbjct: 243 AASAHGRLLADTLFGIEEEAGDLLQAGIAWSTVQPFERAILAEDALRARGGS-----PLV 297 Query: 285 FKSVGCAAWDLAAC 298 FKSVG A WDLAAC Sbjct: 298 FKSVGYALWDLAAC 311 Lambda K H 0.320 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 311 Length of database: 319 Length adjustment: 27 Effective length of query: 284 Effective length of database: 292 Effective search space: 82928 Effective search space used: 82928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory