Align Delta(1)-pyrroline-2-carboxylate/Delta(1)-piperideine-2-carboxylate reductase; Pyr2C/Pip2C reductase; N-methyl-L-amino acid dehydrogenase; EC 1.5.1.21; EC 1.4.1.17 (characterized)
to candidate RR42_RS29130 RR42_RS29130 dehydrogenase
Query= SwissProt::Q4U331 (343 letters) >FitnessBrowser__Cup4G11:RR42_RS29130 Length = 364 Score = 157 bits (396), Expect = 5e-43 Identities = 108/309 (34%), Positives = 151/309 (48%), Gaps = 20/309 (6%) Query: 30 GTSPEVADVLAENCASAQRDGSHSHGIFRIPGYLSSLASGWVD-GKAVPVVEDVGAAFVR 88 G+ A + A++ A G SHG+ IP Y+ S + + V VV + G + Sbjct: 23 GSDAREARLTADHLVGANLSGHDSHGVGMIPKYVMSWQGEQLQLNQRVSVVHEAGG-ILS 81 Query: 89 VDACNGFAQPALAAARSLLIDKARSAGVAILAIRGSHHFAALWPDVEPFAEQGLVALSMV 148 +D G Q A L I++AR GV +L +R SHH + E G++++ V Sbjct: 82 LDGNRGMGQAVTEEAMGLAIERAREHGVCVLGLRASHHLGRVGHWAEQATAAGMISIHFV 141 Query: 149 N--SMTCVVPHGARQPLFGTNPIAFGAPRAGGEPIVFDLATSAIAHGDVQIAAREGRLLP 206 N S V PHG + +GTNP G P AGGEP+V D ATSAIA G V++A +G +P Sbjct: 142 NVLSKPIVAPHGGYEARYGTNPFTIGVPVAGGEPLVMDFATSAIALGKVRVANNKGVAVP 201 Query: 207 AGMGVDRDGLPTQEPRAILD-----GGALLPFGGHKGSALSMMVELLAAGLTGGNFSFEF 261 G +D +G PT +P + GAL PFG HKG L++M ELL A +TGG+ + Sbjct: 202 PGCLLDTEGHPTDDPAVMFPPAGEAQGALRPFGEHKGYVLAVMCELLGAAVTGGH-TIRP 260 Query: 262 DWSKHPGAQTPWTGQLLIVIDPDK-GAGQHFAQRSEELVRQLH------GVGQERLPGD- 313 + H A W L IV DP++ G+ F + V L G LPG+ Sbjct: 261 ETLTHEHA--VWNNMLAIVFDPERLGSSTTFGHEVQAFVDWLRSSHLQPGTDAILLPGEP 318 Query: 314 RRYLERARS 322 R RAR+ Sbjct: 319 ERAWRRARA 327 Lambda K H 0.320 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 364 Length adjustment: 29 Effective length of query: 314 Effective length of database: 335 Effective search space: 105190 Effective search space used: 105190 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory