Align Histidine transport system permease protein HisM (characterized)
to candidate RR42_RS09485 RR42_RS09485 amino acid ABC transporter permease
Query= SwissProt::P0A2I7 (235 letters) >FitnessBrowser__Cup4G11:RR42_RS09485 Length = 216 Score = 110 bits (274), Expect = 3e-29 Identities = 64/206 (31%), Positives = 111/206 (53%), Gaps = 10/206 (4%) Query: 26 TLWLLISSVVMGGLLAVILAVGRVSSNKFIRFPIWLFTYIFRGTPLYVQLLVFYSGMYTL 85 TLW+ + + V G L ++A+ R S + +R ++ I +GTP+ + L + Y G+ L Sbjct: 20 TLWVTLLAFVGGTLAGFLVALARTSRSALLRLASTVYIQIVQGTPVLIVLFLSYYGLSVL 79 Query: 86 EIVKGTDLLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSSFK 145 G L S + +LA+++ AY EI+ G I +VP G+ EA+ A + ++ Sbjct: 80 ----GLKL------SPMTAAMLAMSIYASAYLGEIWRGCIEAVPQGQWEASEALALTRWQ 129 Query: 146 MYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINSATYQPFTAFGI 205 R ++LP A+R+ALP + ++ +T++ V +L + + IN+AT+QPF F + Sbjct: 130 QLRHVVLPQAVRLALPPTVGFSVQLVKNTSITSIIGVIELTRAGQLINNATFQPFAVFVV 189 Query: 206 AAVLYLLISYVLISLFRRAERRWLQH 231 A++Y + + L S RR ERR H Sbjct: 190 VALIYFALCFPLSSAARRMERRLHAH 215 Lambda K H 0.330 0.141 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 116 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 235 Length of database: 216 Length adjustment: 22 Effective length of query: 213 Effective length of database: 194 Effective search space: 41322 Effective search space used: 41322 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory