Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate RR42_RS31735 RR42_RS31735 ABC transporter ATP-binding protein
Query= uniprot:Q88GX0 (260 letters) >FitnessBrowser__Cup4G11:RR42_RS31735 Length = 253 Score = 256 bits (654), Expect = 3e-73 Identities = 133/245 (54%), Positives = 167/245 (68%), Gaps = 5/245 (2%) Query: 20 LIRIEGLNKHYGAFHVLRDIDLQVREGERIVLCGPSGSGKSTLIRCINRLEVAQQGSIQV 79 +IRI L K +G VL+ ID V + +V+ GPSGSGKST +RC N LE A+ G+I++ Sbjct: 6 IIRIRNLGKSFGDHTVLKGIDFDVEPSQVVVVIGPSGSGKSTFLRCCNGLEQAESGTIEI 65 Query: 80 DGIDLA-----ATTREAAQVRSDIGMVFQHFNLFPHMSVLDNCLLAPTSVRGLSRKDAEE 134 G L E ++R+++GMVFQ FNLFPH+SVL N L P +RG SR DAE Sbjct: 66 CGTKLLDQGLLIADPELNRLRTEVGMVFQSFNLFPHLSVLHNVTLGPRMLRGASRDDAER 125 Query: 135 RARMYLSKVGIESQAHKYPSQLSGGQQQRVAIARALCMKPRIMLFDEPTSALDPEMVAEV 194 +A L KVG+ +AH P+ LSGGQ+QRVAIARAL M PR+MLFDEPTSALDPE+V EV Sbjct: 126 KAMALLEKVGLAHKAHAMPASLSGGQKQRVAIARALAMAPRVMLFDEPTSALDPELVGEV 185 Query: 195 LDVLVQLAGTGMTMLCVTHEMGFARQVAERVLFLEGGQIIEDSPPQVFFNQPRTERAKAF 254 L V+ LA GMTM+ VTHEMGFAR+VA+ V+ ++GG IIE PP V F P ER + F Sbjct: 186 LQVMKVLAAEGMTMVVVTHEMGFAREVADVVVVMDGGGIIEAGPPSVIFTAPTQERTRGF 245 Query: 255 LAQIL 259 L +L Sbjct: 246 LQAVL 250 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 253 Length adjustment: 24 Effective length of query: 236 Effective length of database: 229 Effective search space: 54044 Effective search space used: 54044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory