Align 3-keto-5-aminohexanoate cleavage enzyme (EC 2.3.1.247) (characterized)
to candidate RR42_RS34675 RR42_RS34675 NADPH:quinone reductase
Query= BRENDA::Q8RHX2 (272 letters) >FitnessBrowser__Cup4G11:RR42_RS34675 Length = 294 Score = 177 bits (450), Expect = 2e-49 Identities = 107/289 (37%), Positives = 158/289 (54%), Gaps = 22/289 (7%) Query: 4 KLIITAAICGAEVTKEHNPAVPYTVEEIAREAESAYKAGASIIHLHVREDD-GTPTQDKE 62 K IIT A+ G VT E +P +P T +IA A A +AGA+ H+HVR+ + G P+ E Sbjct: 5 KTIITCAVTGNIVTPEQHPGLPVTPAQIATAALEAAEAGAAAAHIHVRDPETGRPSMALE 64 Query: 63 RFRKCIEAIREKCPDVIIQPSTG--------------GAVGMT----DLERLQPTELHPE 104 + + IE IR++ +II +TG A G T ++ L P+ Sbjct: 65 YYAEVIELIRKRNKALIINLTTGPGGRFVPGEDEPRNAAPGTTLVRPEVRVAHIAALRPD 124 Query: 105 MATLDCGTCNFGGDEIFVNTENTIKNFGKILIERGVKPEIEVFDKGMIDYAIRYQKQGFI 164 + +LD T N G D + +NT ++ I+ E GV PE+E+FD G + A + ++G + Sbjct: 125 VCSLDLNTMNSGAD-VVINTPRNVRKMAAIIREAGVMPELEIFDSGDLHMARDFIQEGVL 183 Query: 165 QKPMHFDFVLGVQ--MSASARDLVFMSESIPEGSTWTVAGVGRHQFQMAALAIVMGGHVR 222 P + FVLGV+ +A+ L + +P G+ W+ GVGR +F M A A + GGHVR Sbjct: 184 DGPGLWTFVLGVKYGFAATPETLFYARNMLPPGAHWSAFGVGRAEFPMVAQAWLAGGHVR 243 Query: 223 VGFEDNVYIDKGILAKSNGELVERVVRLAKELGREIATPDEARQILSLK 271 VG EDN+Y+DKG+LA N LV + + K LG +A+P EAR L L+ Sbjct: 244 VGLEDNIYLDKGVLAPDNAALVAKARDIIKSLGGALASPHEARATLGLR 292 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 294 Length adjustment: 26 Effective length of query: 246 Effective length of database: 268 Effective search space: 65928 Effective search space used: 65928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory