Align lysine 6-dehydrogenase (EC 1.4.1.18) (characterized)
to candidate RR42_RS18505 RR42_RS18505 saccharopine dehydrogenase
Query= BRENDA::Q3S559 (368 letters) >FitnessBrowser__Cup4G11:RR42_RS18505 Length = 401 Score = 413 bits (1062), Expect = e-120 Identities = 220/368 (59%), Positives = 265/368 (72%), Gaps = 14/368 (3%) Query: 3 RTQHAITVLGAGKIGFAIALLLQRTGDYAVCVADQDPSRLDAVA-ALGCQTAQIDNDAAL 61 +T + VLGAGKIG IA++L +GDY V + D++P+ L+ V + + Sbjct: 25 QTPMRVVVLGAGKIGRTIAVMLHDSGDYRVTLVDREPTHLEGVPQGIAVRVGDPGQTEDC 84 Query: 62 EAAIAGRHAVLNALPFHRAVAVAGLCARLGVHYFDLTEDVASTHAIHALGRDARAVLMPQ 121 + G AVLNALPFH AV VA + A LGVHYFDLTEDVA+THAI L AR VLMPQ Sbjct: 85 ARLLGGAQAVLNALPFHAAVGVATVAASLGVHYFDLTEDVAATHAIRRLAEGARCVLMPQ 144 Query: 122 CGLAPGFIGIVGNDLARRF----DTLLDLRMRVGGLPRYPTNALRYNLYLEHRGADQRVL 177 CGLAPGFIG+VGNDLA+RF LLDL+MRVG LPRYP+NAL+YNL G Sbjct: 145 CGLAPGFIGVVGNDLAQRFLRGGGELLDLKMRVGALPRYPSNALKYNLTWSTEGLINEYC 204 Query: 178 QSMRGAVDGELVKVPPMEGYETFTLDGVEYEAFNTSGGLGTLPQTLLGKARNVDYKSVRY 237 VDG V+VP +EG E+F LDG+EYEAFNTSGGLGTLP+TL G+AR VDYKS+RY Sbjct: 205 NPCEAIVDGRRVEVPALEGLESFALDGIEYEAFNTSGGLGTLPETLAGRARGVDYKSIRY 264 Query: 238 PGHCAIMKLLLNDLRLRERRELLQDILESAIPATGQDVIVILATASGY-----RGGR--L 290 PGHCA+MKLLLNDLRLRERR+ +++I ESAIPAT QDV+++ A+A+GY +GGR L Sbjct: 265 PGHCAVMKLLLNDLRLRERRDWMREIFESAIPATQQDVVIVFASATGYAASGGKGGRGPL 324 Query: 291 LQEAYSAHIHG-DTVDGHALSAIQLSTAAGICTALDLVVEGALPQRGFVGQESIPLDALL 349 Q ++SA I G DTV GH ++AIQL+TAAGICTALDLV G LPQ GFV QE++PLD L Sbjct: 325 TQASFSARIGGADTVAGH-VNAIQLTTAAGICTALDLVANGELPQAGFVAQEAMPLDVFL 383 Query: 350 ANRHGRIY 357 ANR GR Y Sbjct: 384 ANRFGRHY 391 Lambda K H 0.323 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 470 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 401 Length adjustment: 30 Effective length of query: 338 Effective length of database: 371 Effective search space: 125398 Effective search space used: 125398 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory