Align L-2-aminoadipate aminotransferase monomer (EC 2.6.1.39) (characterized)
to candidate RR42_RS14595 RR42_RS14595 2-aminoadipate aminotransferase
Query= metacyc::MONOMER-6727 (397 letters) >FitnessBrowser__Cup4G11:RR42_RS14595 Length = 395 Score = 352 bits (902), Expect = e-101 Identities = 188/396 (47%), Positives = 258/396 (65%), Gaps = 14/396 (3%) Query: 4 LSWSEAFGKSAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKEEAAEAAARILREK 63 ++W A + A ++ +S IRE+LK+T+RP ++SFAGGLP+P FP +A ARI + Sbjct: 1 MNW--AISRRAQQLTSSAIREILKVTERPEVISFAGGLPSPATFPVAAMEQAVARIFADN 58 Query: 64 GEVALQYSPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAP 123 + ALQY+ TEGY PLR F+A+ V E VLITTGSQQALDL+ KV +D GSPVL+E P Sbjct: 59 PQAALQYAATEGYMPLREFIAKRHAVDVERVLITTGSQQALDLIAKVMIDPGSPVLVETP 118 Query: 124 SYMGAIQAFRLQGPRFLTVPAGEEGPDLDALEEVLKRE---RPRFLYLIPSFQNPTGGLT 180 SY+GA+QAF L P F++VP G D L E L E RFLY +P+FQNPTG Sbjct: 119 SYLGALQAFSLFEPEFVSVP----GDDKSLLPESLTPELTAGARFLYALPNFQNPTGRRM 174 Query: 181 PLPARKRLLQMVMERGLVVVEDDAYRELYFGEARLPSLFELAREAGYPGVIYLGSFSKVL 240 PL R+ L+ E GL++VEDD Y EL + +LPSL + + GVIY+GSFSK+L Sbjct: 175 PLERRQALVARARELGLLLVEDDPYGELSYSGDQLPSLLSMNPD----GVIYMGSFSKIL 230 Query: 241 SPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHELLKEG-FSERLERVRRVYRE 299 +PGLR+ F +A PE KL QAKQ +DLHTP Q L +E++++G + +R +Y Sbjct: 231 APGLRLGFVIAPPELHFKLCQAKQASDLHTPSFTQRLAYEVVRDGLLDSHIPTIRTLYAA 290 Query: 300 KAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVAFVPGGPFFA 359 + QAML +L R +P+ V + P+GGMF+WMELP+GL + + + A+ NVA+VPG PF+A Sbjct: 291 QCQAMLDSLARHMPEGVTWNAPEGGMFIWMELPEGLDSMEILQEAVNRNVAYVPGAPFYA 350 Query: 360 NGGGENTLRLSYATLDREGIAEGVRRLGRALKGLLA 395 + N LRL++ T+ E I +GV LG + +A Sbjct: 351 SNPRRNALRLAFVTVAPERIEQGVAILGTLFREAIA 386 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 508 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 395 Length adjustment: 31 Effective length of query: 366 Effective length of database: 364 Effective search space: 133224 Effective search space used: 133224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory