Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate RR42_RS32140 RR42_RS32140 aldehyde dehydrogenase
Query= BRENDA::P77674 (474 letters) >FitnessBrowser__Cup4G11:RR42_RS32140 Length = 496 Score = 329 bits (843), Expect = 1e-94 Identities = 192/484 (39%), Positives = 275/484 (56%), Gaps = 12/484 (2%) Query: 1 MQHKLLINGELVSGE-GEKQPVYNPATGDVLLEIAEASAEQVDAAVRAADAAFA--EWGQ 57 +++ +LI+GE E GE V++PATG+ + + A +DAAV AA AFA W Sbjct: 15 IRNAMLIDGEWRQAESGETFAVFDPATGEEIARVPAGGAADIDAAVAAAGRAFAGGTWRA 74 Query: 58 TTPKVRAECLLKLADVIEENGQVFAELESRNCGKPLHSAFNDEIPAIVDVFRFFAGAARC 117 P R LLKLAD++E++G A LE+ N GK L + E+ R+ AG A Sbjct: 75 MMPAQRERLLLKLADLVEQHGDELARLETLNNGKLLAFSQGLEVGGSAQWLRYMAGWATK 134 Query: 118 LNGLAAGEYLE-----GHTSMIRRDPLGVVASIAPWNYPLMMAAWKLAPALAAGNCVVLK 172 + G + +++M RR P+GVV +I PWN+PL+MA WK+APALA G VVLK Sbjct: 135 IEGSTLDVSVPFPPGTRYSAMTRRSPVGVVGAIVPWNFPLLMAVWKIAPALACGCTVVLK 194 Query: 173 PSEITPLTALKLAELAKDI-FPAGVINILFGRGKTVGDPLTGHPKVRMVSLTGSIATGEH 231 P+E TPLTAL+LAELA + FP GV+N++ G G G L HP V ++ TGS G Sbjct: 195 PAEETPLTALRLAELALEAGFPPGVLNVVTGDG-VPGAALVAHPGVNKITFTGSTEVGRL 253 Query: 232 IISHTASSIKRTHMELGGKAPVIVFDDADIEAVVEGVRTFGYYNAGQDCTAACRIYAQKG 291 I + I+R +ELGGK+PVIV DD D ++G + N GQ CTA R+Y + Sbjct: 254 IGARCGQDIRRVSLELGGKSPVIVLDDCDPAHAIQGAAGAIFLNQGQVCTAGSRLYVARR 313 Query: 292 IYDTLVEKLGAAVATLKSGAPDDESTELGPLSSLAHLERVGKAVEEAKATGHIKVITGGE 351 YD +VE LG G+ D ++++GPL S H ++V + ++ G ++ GG Sbjct: 314 HYDQVVEGLGKVANATVLGSGLDPASQMGPLVSSRHRDKVMGLIGTGRSEG-ADIVAGGT 372 Query: 352 KRKGNGYYYAPTLLA-GALQDDAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGLASSV 410 GY+ PT++A A +D +V++EVFGPVV PFD+ E V+ AN S+YGL +S+ Sbjct: 373 ALDRPGYFVRPTVVANAACKDLTLVREEVFGPVVVAMPFDDPEAVLAEANRSEYGLGASI 432 Query: 411 WTKDVGRAHRVSARLQYGCTWVNTHFMLVSEMPHGGQKLSGYGKDMSLYGLEDYTVVRHV 470 W+ D+ R+ L G WVNTH ++ MP GG K SG G++ +E YT ++ V Sbjct: 433 WSNDLRAVQRLVDGLDAGTVWVNTHNIVDPNMPFGGYKASGVGREHGRSAIEAYTEIKSV 492 Query: 471 MVKH 474 + + Sbjct: 493 CMAY 496 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 593 Number of extensions: 35 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 474 Length of database: 496 Length adjustment: 34 Effective length of query: 440 Effective length of database: 462 Effective search space: 203280 Effective search space used: 203280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory