Align Inner membrane ABC transporter permease protein (characterized, see rationale)
to candidate RR42_RS18605 RR42_RS18605 sugar ABC transporter permease
Query= uniprot:A8LLL4 (385 letters) >FitnessBrowser__Cup4G11:RR42_RS18605 Length = 295 Score = 96.3 bits (238), Expect = 1e-24 Identities = 65/229 (28%), Positives = 110/229 (48%), Gaps = 6/229 (2%) Query: 157 TFANYENMLLDPNNSEGMARAFFNTLTVTIPATIIPILVAAFAAYALAWMEFPGRALLIA 216 TFA+++ +L D E + NT+ V+ +T + + AAYA+ + F G + Sbjct: 72 TFAHFKKLLFDTPYPEWL----LNTVIVSTISTFASLAASVLAAYAIERLRFQGAKQVGL 127 Query: 217 LIVGLLVVPLQLALIPLLTLHNAIGIGKGYLGTWLAHTGFGMPLAIYLLRNYMVGLPRDI 276 + ++P + IPL ++ +G+ L + F +P +LL Y +P ++ Sbjct: 128 AVFLAYLIPPSILFIPLASIVFQLGLFDTRWALILTYPTFLIPFCTWLLMGYFRSIPYEL 187 Query: 277 IENAKVDGATDFQIFTKIVLPLSFPALASFAIFQFLWTWNDLLVAKVFLIDATGQTTVMT 336 E A +DGAT ++I KI+LPL+ P L S IF F +WN+ + A F I ++ TV Sbjct: 188 EECALIDGATRWEILVKIILPLAVPGLISAGIFAFTLSWNEFIYALTF-ISSSEVKTVPV 246 Query: 337 NQIVELLGTRGGNWEILATAAFVSIAVPLLVFFSMQRFLVRGLLAGSVK 385 + EL+ +W L A + LV+ + V G + G+VK Sbjct: 247 GIVTELIEGDVYHWGALMAGALLGSLPVALVYSFFVEYYVSG-MTGAVK 294 Lambda K H 0.323 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 295 Length adjustment: 28 Effective length of query: 357 Effective length of database: 267 Effective search space: 95319 Effective search space used: 95319 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory