Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate RR42_RS03865 RR42_RS03865 hydroxyacid dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >FitnessBrowser__Cup4G11:RR42_RS03865 Length = 313 Score = 175 bits (444), Expect = 1e-48 Identities = 117/291 (40%), Positives = 157/291 (53%), Gaps = 23/291 (7%) Query: 15 LAYLQQHAQVVQVDATQHDAFVAALKDADGGIGSSVKITPAMLEGATRLKALSTISVGFD 74 LA+L++HAQ +V A+ A GI T + RL A+ + VG+D Sbjct: 36 LAWLREHAQQARV----------AVTSARHGI------TAEAIAAMPRLAAIVSFGVGYD 79 Query: 75 QFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVELAEWVKAGHWQHSIGPAL 134 + RGI ++NTPDVL + AD F L+L +AR + +V+AG W P Sbjct: 80 SIALDAARARGIQVSNTPDVLNDCVADLAFGLLLDAARGIAHGDRFVRAGKWGRDSFPLT 139 Query: 135 FGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRSANPQAEEAYGARRVELAELL 194 V GK LGI+GLGRIG VA+RA GF M + Y NR A A + +L L Sbjct: 140 --TRVSGKKLGILGLGRIGEKVAQRAT-GFGMDIAYHNRRARDGAPWRH---EPDLKALA 193 Query: 195 ATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGATVDEKALIEALQNGTIHGA 254 ADF+ + PET+ L+ A ++++ IL+N SRG+ VDE AL+ AL+NG + GA Sbjct: 194 GWADFLAVTCVGGPETEGLVSAGIIEALGPKGILVNVSRGSVVDEDALVAALRNGRLGGA 253 Query: 255 GLDVFETEPLPSDSPLLKLANVVALPHIGSATHETRHAMARNAAENLVAAL 305 GLDVF EP ++ L L NVV PH+ S THETR AMA +NL A L Sbjct: 254 GLDVFRAEPQVPEA-LFALDNVVLAPHVASGTHETRAAMAALVFDNLDAFL 303 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 313 Length adjustment: 27 Effective length of query: 294 Effective length of database: 286 Effective search space: 84084 Effective search space used: 84084 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory