Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate RR42_RS18600 RR42_RS18600 ABC transporter permease
Query= reanno::Koxy:BWI76_RS01825 (514 letters) >FitnessBrowser__Cup4G11:RR42_RS18600 Length = 299 Score = 116 bits (290), Expect = 1e-30 Identities = 85/247 (34%), Positives = 128/247 (51%), Gaps = 20/247 (8%) Query: 259 IGWDNFTRVFQDEGIQKPFFAIFVWTVVFSVLTVILTVAVGMVLACLVQWEALKGKAIYR 318 IG N++ + D Q F +TVV SV+ A+G+ LA L+ + L K+ +R Sbjct: 52 IGLSNYSYLAGDSLTQLALFNTIFYTVVASVVKF----ALGLWLALLLN-KNLPFKSFFR 106 Query: 319 VLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGIKPA--WFSDPTTARTMIIIVN 376 +++LP+ VP+ +S L F +++ F I+ L L I + DP AR I N Sbjct: 107 AIVLLPWIVPTALSALAFWWIYDAQFSIISWTLVKLGLIDRYIDFLGDPWLARFSTIAAN 166 Query: 377 TWLGYPYMMILCMGLLKAIPDDLYEASAMDGATPFQNFFKITLPLLIKPLTPLMIASFAF 436 W G P++ I + L+ I LYEA+++DG TP+Q F +TLPLL + +M S F Sbjct: 167 VWRGIPFVAISLLAGLQTISPTLYEAASIDGVTPWQQFRYVTLPLLTPIIAVVMTFSVLF 226 Query: 437 NFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVSYTYRIAFEGGGGQDFGLAAAIATLI-- 494 F +F LI +LT GG P T L+ + +++ A GG G AAIAT++ Sbjct: 227 TFTDFQLIYVLTRGG--------PLNATHLMATLSFQRAIPGG---SLGEGAAIATMMVP 275 Query: 495 FLLVGLL 501 FLL +L Sbjct: 276 FLLAAIL 282 Lambda K H 0.325 0.140 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 438 Number of extensions: 31 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 514 Length of database: 299 Length adjustment: 31 Effective length of query: 483 Effective length of database: 268 Effective search space: 129444 Effective search space used: 129444 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory