Align ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized)
to candidate RR42_RS12955 RR42_RS12955 glycerol-3-phosphate ABC transporter ATP-binding protein
Query= BRENDA::P68187 (371 letters) >FitnessBrowser__Cup4G11:RR42_RS12955 Length = 367 Score = 333 bits (855), Expect = 3e-96 Identities = 183/363 (50%), Positives = 242/363 (66%), Gaps = 8/363 (2%) Query: 1 MASVQLQNVTKAW-GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD 59 MA + L+NV K + G V V I+++I++GEF+V VGPSGCGKSTLLRM+AGLE I+ G+ Sbjct: 1 MAKLSLRNVQKTYAGNVKVVHGIDMEINDGEFIVIVGPSGCGKSTLLRMVAGLEAISGGE 60 Query: 60 LFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAE 119 + IG+K +N PAER + MVFQ+YALYPH+SV +NM++GLK+ G K I QRV A Sbjct: 61 VHIGDKVVNHLEPAERDIAMVFQNYALYPHMSVYDNMAYGLKIRGMDKSEIEQRVKHAAG 120 Query: 120 VLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRL 179 +L+LA LL+RKP+ALSGGQRQRVA+GR +V EP+VFL DEPLSNLDA LRVQMR+E+ L Sbjct: 121 ILELAPLLERKPRALSGGQRQRVAMGRAIVREPAVFLFDEPLSNLDAKLRVQMRLELKEL 180 Query: 180 HKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKM 239 H+RL T +YVTHDQVEAMTLAD+++VL+ G V Q+G PLE+Y PA FVA FIGSP M Sbjct: 181 HRRLRTTSMYVTHDQVEAMTLADRMMVLNGGSVEQIGTPLEVYARPASTFVASFIGSPPM 240 Query: 240 NFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMS----LGIRPEHLLPSDI 295 N +PV T + Q+ + Q P + +G ++ LG+RPEH+ P Sbjct: 241 NLVPVTRTNGGQGEAQMRVEQKPGAQ-GAPATLGHLPMGLHLPERALLGLRPEHIEPCAA 299 Query: 296 ADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLF 355 + I E EV++VE LG ++ + + Q +V R + + V G I E H F Sbjct: 300 HEAIAEIEVRLVEALGADSYAYGTLGG--QPVVVRLDSNMPVSSGDRLPITAAAEHLHFF 357 Query: 356 RED 358 D Sbjct: 358 DAD 360 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 367 Length adjustment: 30 Effective length of query: 341 Effective length of database: 337 Effective search space: 114917 Effective search space used: 114917 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory