Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate RR42_RS27800 RR42_RS27800 ABC transporter ATP-binding protein
Query= BRENDA::Q70HW1 (384 letters) >FitnessBrowser__Cup4G11:RR42_RS27800 Length = 357 Score = 226 bits (577), Expect = 6e-64 Identities = 150/357 (42%), Positives = 203/357 (56%), Gaps = 25/357 (7%) Query: 4 VLLEHIYKTYPGQTEPTVKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEGNLY 63 + L H KT+ T ++ +LDI E V +GPSGCGKTTTLR+IAGLE G + Sbjct: 7 ITLRHCGKTFADGTL-ALQPLDLDIGAGETVVLLGPSGCGKTTTLRIIAGLEFPDAGGVV 65 Query: 64 I-GDRRVNDVPPKDRDIAMVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAAKI 122 + GD V +P + R + MVFQ+YAL+P+MTV +N+A+GL++R++ A RRV E + Sbjct: 66 MFGDNDVTPLPIEQRGVGMVFQSYALFPNMTVAENIAYGLRVRRIDAAARRRRVDEMLAM 125 Query: 123 LDIAHLLDRKPKALSGGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRKLH 182 + + +R+ LSGGQRQRVAL RAI +P+V L+DEPL+ LDAKLR +RA+I +L Sbjct: 126 MHLGPFAERRIDQLSGGQRQRVALARAIAVQPRVLLLDEPLTALDAKLRDALRADINQLL 185 Query: 183 QRLQTTVIYVTHDQTEAMTMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFIGSPAMN 242 + L T +YVTHDQ EAM +GDRI+VM G I Q TPQ +Y P N FVA FIG+ MN Sbjct: 186 RSLHITAVYVTHDQAEAMALGDRIIVMDRGRIAQTGTPQQIYRAPANAFVADFIGT--MN 243 Query: 243 FIRGEIVQDGDAFYFRAPSISLRLPEG---RYGVLKASGAIGKP-VVLGVRPEDLHDEEV 298 R V + DA+ R+P G R+G + A P L RPED V Sbjct: 244 --RLPAVLEADAW---------RVPGGLVPRHGTAASLAAAPSPRAELLFRPED-----V 287 Query: 299 FMTTYPDSVLQMQVEVVEHMGSEVYLHTSIG-PNTIVARVNPRHVYHVGSSVKLAID 354 + D+ L V +G+ L +G P +V R + G V L +D Sbjct: 288 ALAQAEDAHLGGSVVTALFLGNYTRLLVDVGAPAPLVVDTTRRDGWLAGDRVGLRLD 344 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 357 Length adjustment: 30 Effective length of query: 354 Effective length of database: 327 Effective search space: 115758 Effective search space used: 115758 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory