Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate RR42_RS12955 RR42_RS12955 glycerol-3-phosphate ABC transporter ATP-binding protein
Query= TCDB::Q8DT25 (377 letters) >FitnessBrowser__Cup4G11:RR42_RS12955 Length = 367 Score = 319 bits (817), Expect = 9e-92 Identities = 189/390 (48%), Positives = 242/390 (62%), Gaps = 39/390 (10%) Query: 1 MTTLKLDNIYKRYP-NAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITE 59 M L L N+ K Y N K V +++I+D EFIV VGPSGCGKST LRM+AGLE I+ Sbjct: 1 MAKLSLRNVQKTYAGNVK--VVHGIDMEINDGEFIVIVGPSGCGKSTLLRMVAGLEAISG 58 Query: 60 GNLYIDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEA 119 G ++I DK++N P +RDIAMVFQNYALYPHMSVY+NMA+GLK+R K +I +RV A Sbjct: 59 GEVHIGDKVVNHLEPAERDIAMVFQNYALYPHMSVYDNMAYGLKIRGMDKSEIEQRVKHA 118 Query: 120 AEILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIA 179 A IL L LERKP LSGGQRQRVAMGRAIVR+ VFL DEPLSNLDAKLRV MR E+ Sbjct: 119 AGILELAPLLERKPRALSGGQRQRVAMGRAIVREPAVFLFDEPLSNLDAKLRVQMRLELK 178 Query: 180 KIHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPAN 239 ++HRR+ T++YVTHDQ EAMTLADR+++++ G +EQIGTP E+Y PA+ Sbjct: 179 ELHRRLRTTSMYVTHDQVEAMTLADRMMVLNG----------GSVEQIGTPLEVYARPAS 228 Query: 240 KFVAGFIGSPAMNFFEVT-------VEKERLVNQDGLSLA------LPQGQEKILEEKGY 286 FVA FIGSP MN VT + R+ + G A LP G + Sbjct: 229 TFVASFIGSPPMNLVPVTRTNGGQGEAQMRVEQKPGAQGAPATLGHLPMGL--------H 280 Query: 287 LGKKVTLGIRPEDISSDQIVHETFPNASVTADILVSELLGSESMLYVKFGSTEFTARVNA 346 L ++ LG+RPE I HE A ++ + E LG++S Y G R+++ Sbjct: 281 LPERALLGLRPEHI-EPCAAHE----AIAEIEVRLVEALGADSYAYGTLGGQPVVVRLDS 335 Query: 347 RDSHSPGEKVQLTFNIAKGHFFDLETEKRI 376 S G+++ +T HFFD ++ KRI Sbjct: 336 NMPVSSGDRLPITAAAEHLHFFDADSGKRI 365 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 367 Length adjustment: 30 Effective length of query: 347 Effective length of database: 337 Effective search space: 116939 Effective search space used: 116939 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory