Align MalK, component of Maltose and maltooligosaccharide porter (characterized)
to candidate RR42_RS11230 RR42_RS11230 peptide ABC transporter ATP-binding protein
Query= TCDB::Q97UG5 (617 letters) >FitnessBrowser__Cup4G11:RR42_RS11230 Length = 347 Score = 212 bits (540), Expect = 2e-59 Identities = 122/325 (37%), Positives = 184/325 (56%), Gaps = 4/325 (1%) Query: 6 DSLLKVNELTAGYFNQDGFVIGVTNVNFEVYPNEIFAIAGESGCGKSTLAMAIYGLLKYP 65 + LL+V++L + G V V++ V + + GESGCGKS A++I LL P Sbjct: 14 EPLLEVDDLHTHFDTLTGPARSVNGVSYTVRAGQTLGVVGESGCGKSVTALSIMRLLPTP 73 Query: 66 GVVLRGHVYLKDKDILSITQEELRKLRMKEFVYVPQFAMDALDPVAKIGDQMMRAAVSH- 124 +RG V L+ D+L +++ E+R++R + Q M +L+PV IG Q+ H Sbjct: 74 PARMRGAVRLRGIDLLQLSEREMRRIRGNRVSMIFQEPMTSLNPVLTIGRQIAETVQLHQ 133 Query: 125 GVNVEEARKLIKEKLELVDLPY--NVVNMYPHELSGGMRQRVVIATSILLNPSLIILDEP 182 G + +A K E L LV +P VN YPH+LSGGMRQRV+IA ++ NP ++I DEP Sbjct: 134 GASRADALKRAAEMLRLVQIPEPERRVNEYPHQLSGGMRQRVMIALALACNPEVLIADEP 193 Query: 183 TTGLDVIVQYEILKDLKRIQRQLGVSLVIISHDISMLLMISDRVGIMYAGEIVEIGSKEE 242 TT LDV +Q +IL ++R+Q++LG+ +V+I+HD+ ++ DRV +MYAG VE S + Sbjct: 194 TTALDVTIQAQILDLIRRLQKELGMGVVMITHDLGVVAECCDRVIVMYAGRKVEEASVID 253 Query: 243 IIKRPSHPYTYLLISSLPSLVKRREKLLSIPGNPPLMLSKVPNSCRFYDRCPFKMEKCST 302 + RP HPYT L++S+PS+ ++L IPG P + C F RCP +C+ Sbjct: 254 LFDRPLHPYTRALMASMPSMNTSSQRLAEIPGLVP-SPQQARRGCAFAARCPHADTRCAR 312 Query: 303 LNPALGDIMDGHKARCFLQKGGYVD 327 P L H CF + G ++ Sbjct: 313 EIPQLTRHGADHAVACFAVEEGRIE 337 Score = 156 bits (394), Expect = 2e-42 Identities = 90/244 (36%), Positives = 145/244 (59%), Gaps = 7/244 (2%) Query: 374 LSEPINAVNDVSFELKKGTITALVGGSGHGKS----TIAKILAGMIQQTSGKIILLGKDV 429 L+ P +VN VS+ ++ G +VG SG GKS +I ++L + G + L G D+ Sbjct: 29 LTGPARSVNGVSYTVRAGQTLGVVGESGCGKSVTALSIMRLLPTPPARMRGAVRLRGIDL 88 Query: 430 SEYGVRNSMWYKEN-VQMIFQDPYSSLDPRHTVRWHVERPLLIHKKVSNKDQLLPKIIEV 488 + R + N V MIFQ+P +SL+P T+ + + +H+ S D L + E+ Sbjct: 89 LQLSEREMRRIRGNRVSMIFQEPMTSLNPVLTIGRQIAETVQLHQGASRADAL-KRAAEM 147 Query: 489 LKNVGLKPPEKYLYKYPHELSGGERQRVAIARATAVEPKVLVADEPVSMLDASLRAGILN 548 L+ V + PE+ + +YPH+LSGG RQRV IA A A P+VL+ADEP + LD +++A IL+ Sbjct: 148 LRLVQIPEPERRVNEYPHQLSGGMRQRVMIALALACNPEVLIADEPTTALDVTIQAQILD 207 Query: 549 LIKKFKKN-GISILYITHDIATVNYIADEIMVIYKGRIVEKGNTYEVISNPSHEYTKRLI 607 LI++ +K G+ ++ ITHD+ V D ++V+Y GR VE+ + ++ P H YT+ L+ Sbjct: 208 LIRRLQKELGMGVVMITHDLGVVAECCDRVIVMYAGRKVEEASVIDLFDRPLHPYTRALM 267 Query: 608 EAVP 611 ++P Sbjct: 268 ASMP 271 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 25 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 617 Length of database: 347 Length adjustment: 33 Effective length of query: 584 Effective length of database: 314 Effective search space: 183376 Effective search space used: 183376 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory