Align MalK, component of Maltose and maltooligosaccharide porter (characterized)
to candidate RR42_RS18195 RR42_RS18195 methionine ABC transporter ATP-binding protein
Query= TCDB::Q97UG5 (617 letters) >FitnessBrowser__Cup4G11:RR42_RS18195 Length = 332 Score = 216 bits (550), Expect = 1e-60 Identities = 125/319 (39%), Positives = 185/319 (57%), Gaps = 10/319 (3%) Query: 9 LKVNELTAGYFNQDGFVIGVTNVNFEVYPNEIFAIAGESGCGKSTLAMAIYGLLKYPGVV 68 L V L +F + G V +V+F V EI + GESG GKS +I GL+ PG V Sbjct: 6 LVVEGLKTQFFTRGGVARAVDDVSFSVGRGEIMGLVGESGSGKSMTGYSIMGLIDPPGKV 65 Query: 69 LRGHVYLKDKD-----ILSITQEELRKLRMKEFVYVPQFAMDALDPVAKIGDQMMRAAVS 123 + G + L +D + ++T ++R +R + Q M L+PV +I QM+ A ++ Sbjct: 66 VDGRIELTSRDGVTRDLRNLTPAQMRDVRGNRIAMIFQDPMMTLNPVLRIDTQMIEAVLA 125 Query: 124 HG-VNVEEARKLIKEKLELVDLPY--NVVNMYPHELSGGMRQRVVIATSILLNPSLIILD 180 H V+ AR+ + L V +P + YPH+ SGGMRQRV IA ++L P LII D Sbjct: 126 HEKVDKAVARERSRNALARVGIPSPDERLRAYPHQFSGGMRQRVAIAIALLNKPDLIIAD 185 Query: 181 EPTTGLDVIVQYEILKDLKRIQRQLGVSLVIISHDISMLLMISDRVGIMYAGEIVEIGSK 240 EPTT LDV +Q +IL +++++ R+ G +L+ I+HD+S++ ++D V +MYAG+IVE G Sbjct: 186 EPTTALDVTIQGQILYEMQKLCRESGTALIWITHDLSVVAGLADTVCVMYAGKIVEAGDV 245 Query: 241 EEIIKRPSHPYTYLLISSLPSLVKRREKLLSIPGNPPLMLSKVPNSCRFYDRCPFKMEKC 300 ++++RP HPYT+ LISS PS R L IPG P +L+ +P C F +RC + + C Sbjct: 246 RQVLERPEHPYTHGLISSAPSRNPRGAPLRQIPGMTPSLLN-LPAGCAFRERCTYATDVC 304 Query: 301 STLNPALGDIMDGHKARCF 319 T P L DG + RCF Sbjct: 305 KTA-PPLDTAADGRRLRCF 322 Score = 147 bits (372), Expect = 5e-40 Identities = 89/243 (36%), Positives = 138/243 (56%), Gaps = 12/243 (4%) Query: 380 AVNDVSFELKKGTITALVGGSGHGKSTIAKILAGMIQQ----TSGKIILLGKDVSEYGVR 435 AV+DVSF + +G I LVG SG GKS + G+I G+I L +D +R Sbjct: 24 AVDDVSFSVGRGEIMGLVGESGSGKSMTGYSIMGLIDPPGKVVDGRIELTSRDGVTRDLR 83 Query: 436 NSMWYK------ENVQMIFQDPYSSLDPRHTVRWHVERPLLIHKKVSNKDQLLPKIIEVL 489 N + + MIFQDP +L+P + + +L H+KV +K + L Sbjct: 84 NLTPAQMRDVRGNRIAMIFQDPMMTLNPVLRIDTQMIEAVLAHEKV-DKAVARERSRNAL 142 Query: 490 KNVGLKPPEKYLYKYPHELSGGERQRVAIARATAVEPKVLVADEPVSMLDASLRAGILNL 549 VG+ P++ L YPH+ SGG RQRVAIA A +P +++ADEP + LD +++ IL Sbjct: 143 ARVGIPSPDERLRAYPHQFSGGMRQRVAIAIALLNKPDLIIADEPTTALDVTIQGQILYE 202 Query: 550 IKKF-KKNGISILYITHDIATVNYIADEIMVIYKGRIVEKGNTYEVISNPSHEYTKRLIE 608 ++K +++G ++++ITHD++ V +AD + V+Y G+IVE G+ +V+ P H YT LI Sbjct: 203 MQKLCRESGTALIWITHDLSVVAGLADTVCVMYAGKIVEAGDVRQVLERPEHPYTHGLIS 262 Query: 609 AVP 611 + P Sbjct: 263 SAP 265 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 489 Number of extensions: 23 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 617 Length of database: 332 Length adjustment: 33 Effective length of query: 584 Effective length of database: 299 Effective search space: 174616 Effective search space used: 174616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory