Align ABC transporter for D-Trehalose, permease component 2 (characterized)
to candidate RR42_RS22885 RR42_RS22885 sugar ABC transporter permease
Query= reanno::Smeli:SM_b20327 (276 letters) >FitnessBrowser__Cup4G11:RR42_RS22885 Length = 288 Score = 145 bits (367), Expect = 7e-40 Identities = 95/278 (34%), Positives = 152/278 (54%), Gaps = 17/278 (6%) Query: 8 RTAFYALVAVIILVAVFPFYYAILTSLKSGTAL-------FRIDYWPTDISLANYAGIFS 60 R A++AV FPFY+ ++T+ K L F + PT L N +F Sbjct: 18 RFGHVAILAVFAGFCAFPFYWMLITTFKDVHDLINTANNPFLFNQPPT---LDNLRVLFL 74 Query: 61 HGTFVRNLGNSLLVATLVVAISLLLAVTAAYALARVR-FRGRGLLLLTILSVSMFPQIAV 119 ++R + N+LLV +VVAI+LLLAV A Y+LAR+ RGR L + L+ + P + Sbjct: 75 ETQYLRWIANTLLVGAMVVAITLLLAVPAGYSLARLAGSRGRQLAIAIFLTY-LIPPTIL 133 Query: 120 LAGLFELIRFVGIFNTPLALIFSYMIFTLPFTVWVLTTFMRDLPIEIEEAAIVDGASPWV 179 +I +G+ ++ +L+ Y FT+PF W++ F + +P +IEEAA++DG S + Sbjct: 134 FIPFSRIIGALGLQDSLWSLVLVYPSFTVPFCTWLMMGFFKAVPRDIEEAAMMDGLSRFG 193 Query: 180 VITRVFMPLMWPALVTTGLLAFIAAWNEFLFALTFTSSNTQRTVPVAIA--LLSGGSQFE 237 +V +PL ++T + EF++ALTF +S++Q TV V + L+ G F Sbjct: 194 AFLKVVVPLSSAGILTVVIFTLTLVMQEFVYALTFITSSSQYTVSVGVPTFLVRGDVYF- 252 Query: 238 IPWGNIMAASVIVTVPLVVLVLIFQRRIISGLTAGGVK 275 WG++M A ++V+VP+ VL +F R ++G T G VK Sbjct: 253 --WGSLMGACLVVSVPVAVLYNLFVDRFVAGFTVGAVK 288 Lambda K H 0.332 0.143 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 288 Length adjustment: 26 Effective length of query: 250 Effective length of database: 262 Effective search space: 65500 Effective search space used: 65500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory