Align mannitol 2-dehydrogenase (EC 1.1.1.67) (characterized)
to candidate RR42_RS09405 RR42_RS09405 butanediol dehydrogenase
Query= BRENDA::Q83VI5 (338 letters) >FitnessBrowser__Cup4G11:RR42_RS09405 Length = 357 Score = 147 bits (371), Expect = 4e-40 Identities = 106/359 (29%), Positives = 171/359 (47%), Gaps = 33/359 (9%) Query: 1 MEALVLTGTKKLEVENIEQPEVKPNE--VLIHTAFAGICGTDHALYAGLPGSADAVPP-- 56 M+A V G + VE + P+ KP E V I + GICG+D Y P P Sbjct: 1 MKAAVWRGRHDVRVEEVRVPD-KPAEGWVKIRVHWCGICGSDLHEYVAGPVFIPVDHPHP 59 Query: 57 -------IVLGHENSGVVAEIGSDVTNVAVGDRVTIDPNIYCGQCKYCRTARPELCENLS 109 +LGHE SG +AE+G+ VT VG+RVT D +CG+C YC +CE+L+ Sbjct: 60 LTGLKGQCILGHEFSGEIAELGAGVTGFKVGERVTADACQHCGKCYYCTHGLYNICESLA 119 Query: 110 AVGVTRNGGFEEYFTAPASVVYQIPDNVSLKSAAVVEPISCAVHGIQLLKVTPYQKALVI 169 G+ NG F EY PA ++Y++P+N ++ A++EP++ +H ++ Q +V+ Sbjct: 120 FTGLMNNGAFAEYVNVPAELLYKLPENFPTEAGALIEPLAVGLHAVKKAGNIVGQTVVVV 179 Query: 170 GDGFMGELFVQILQAYGIHQVDLAGIVPEKLAMNKEK---FGVKNTYNTKDGDKIPE--- 223 G G +G + +A G ++ I E + K+K G + K+ D I + Sbjct: 180 GAGTIGLCTIMCAKAAGAGRI----IALEMSSARKKKALEVGANVVIDPKECDAIAQVKA 235 Query: 224 --GTY--DVVVEAVGLPQTQEAAIEASARGAQVLMFGVGGPDAKFQMNTYEVFQKQLTIQ 279 G Y DV E +G T + AI+ + + +M G+ + F N +E+ + I Sbjct: 236 LTGGYGADVSFECIGNKATAKLAIDVIRKAGKCVMVGIFEEPSAF--NFFEIVSTEKEII 293 Query: 280 GSFINPNAFEDSLALLSSGKLDVESLMSHELDY-----QTVDDFVNGKLGVVSKAVVKV 333 GS F D + ++ G++DV+ L++ + Q ++ VN K G V V V Sbjct: 294 GSLAYNGEFADVIRFIADGRIDVQPLITGRISLADIVSQGFEELVNNKDGNVKIIVQPV 352 Lambda K H 0.316 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 357 Length adjustment: 29 Effective length of query: 309 Effective length of database: 328 Effective search space: 101352 Effective search space used: 101352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory