Align ABC-type sugar transport system, periplasmic component protein (characterized, see rationale)
to candidate RR42_RS32885 RR42_RS32885 LacI family transcriptional regulator
Query= uniprot:D8IZC6 (316 letters) >FitnessBrowser__Cup4G11:RR42_RS32885 Length = 321 Score = 117 bits (292), Expect = 5e-31 Identities = 95/297 (31%), Positives = 146/297 (49%), Gaps = 14/297 (4%) Query: 13 LLLAAAAQPAMAADKPLKSVGVTVGDLANPFFVAIAKGAESGAHKINPDAKVTVVSSKYD 72 L L A PA A + + V + NPFF + +GA++ A +N + + Sbjct: 13 LALGILAAPAHADGE---RIAVFTKNQTNPFFQVVRQGADAAAKSMNARVTHYIPTKPDS 69 Query: 73 LNTQVGQIENFIANKVDLIVLNAADSKGVGPAVKKAQKAGIVVVAV-DVAAAGADVT-VM 130 + Q+ QIE+ I K D IV D K +GP VKK A I VV V D + G V+ + Sbjct: 70 IPEQMSQIEDVIVKKADAIVFVPVDYKAMGPGVKKINAANIPVVNVTDKSDVGNFVSFIG 129 Query: 131 SDNTMAGAESCKFLAEKLQGKGNVVIVNGPPVSAV-MDRVTGCKAEFKKSPGIKILSDNQ 189 + + G ++ L + + GKGNVV++ G S +DRV G K PGIK+++ +Q Sbjct: 130 ASDYDLGLKTATHLFKAMGGKGNVVLLEGIKGSLTNIDRVRGMHDALKAFPGIKLVA-SQ 188 Query: 190 NAGGSRDGGMTTMSNLLAAQPKIDAVFAINDPTAIGAELAIRQAKRSDIKWISGVDGAPD 249 A R + M NL+ + P+IDA+FA ND AIGA A++ A R + +SG++G + Sbjct: 189 PANYQRLQALQVMENLMQSYPQIDAIFATNDAMAIGAIEALQGANRKAL--VSGINGTQE 246 Query: 250 AERALKDSKSLFAASPAQDPYGMAAESVAIGYAVMNGRA-PQQKVKLLPVKLITRDN 305 A A+K L D G A + + A+ R P + +LP ++ + N Sbjct: 247 AIDAIKAGTMLATG----DYNGFAQGCLGMTAAIRKLRGMPVTQSIVLPATVVDKTN 299 Lambda K H 0.314 0.129 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 321 Length adjustment: 27 Effective length of query: 289 Effective length of database: 294 Effective search space: 84966 Effective search space used: 84966 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory