Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate RR42_RS03365 RR42_RS03365 ribose ABC transporter permease
Query= uniprot:D8IZC8 (344 letters) >FitnessBrowser__Cup4G11:RR42_RS03365 Length = 333 Score = 338 bits (866), Expect = 2e-97 Identities = 187/341 (54%), Positives = 244/341 (71%), Gaps = 15/341 (4%) Query: 9 THDAVPPGARRSSST----TAQWLLHRLGMLPVLVVLYLLFYGLTLYLSGDGTSNFASAE 64 T A GA + T T Q L LGMLPVLV+L + F LT NFA + Sbjct: 2 TRPAASTGAPLPAGTLGRLTTQERLRALGMLPVLVLLCIGFSVLT--------ENFAGWQ 53 Query: 65 NTMNILRQVAINLVLAAGMTFVILTAGIDLSVGSVLAVSAVLGMQVSLGAAPGW-AIPMF 123 N I +Q +IN+VLAAGMTFVILT GIDLSVGS+L++SAV+ M VSL G ++P Sbjct: 54 NLSIIAQQASINMVLAAGMTFVILTGGIDLSVGSILSISAVVAMLVSLMPQLGMLSVPAA 113 Query: 124 IFSGLVMGMVNGAMVALLNINAFVVTLGTMTAFRGAAYLLADGTTVLNNDIPSFEWIGNG 183 + GL+ G+VNGA+VA + + F+VTLGT+TA RG A L+ + +T+ N DI F +IGNG Sbjct: 114 LLCGLLFGIVNGALVAFMKLPPFIVTLGTLTAVRGLARLVGNDSTIYNPDI-GFAFIGNG 172 Query: 184 DFLHVPWLIWVAVAVVLLSWVILRKTVLGMHIYAIGGNLQAARLTGIRVGLVLLFVYSIS 243 + L VPWL+ +A AVV +SW +LR+TVLG+ IYA+GGN +AARL+GI+V +VLLFVY++S Sbjct: 173 EVLGVPWLVIIAFAVVAVSWFVLRRTVLGLQIYAVGGNAEAARLSGIKVWVVLLFVYAVS 232 Query: 244 GLFSGLAGAMSASRLYGANG-NWGSGYELDAIAAVVLGGTSLMGGVGSIWGTVVGALIIG 302 GL +GL G MS++RLY ANG G YELDAIAAV+LGGTS +GG GSI GT+VGALII Sbjct: 233 GLLAGLGGVMSSARLYAANGLQLGQSYELDAIAAVILGGTSFVGGTGSIVGTLVGALIIA 292 Query: 303 VMNNGLTILGLSSFWQYVAKGAVIVLAVILDKWRQKDAAQS 343 V++NGL +LG+S WQY+ KG VI+ AV LD +R+K +A++ Sbjct: 293 VLSNGLVLLGVSDIWQYIIKGLVIIGAVALDSYRRKGSART 333 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 333 Length adjustment: 28 Effective length of query: 316 Effective length of database: 305 Effective search space: 96380 Effective search space used: 96380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory