Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate RR42_RS35220 RR42_RS35220 peptide ABC transporter ATP-binding protein
Query= TCDB::Q9X271 (324 letters) >FitnessBrowser__Cup4G11:RR42_RS35220 Length = 327 Score = 299 bits (766), Expect = 5e-86 Identities = 163/317 (51%), Positives = 207/317 (65%), Gaps = 2/317 (0%) Query: 4 LLNVNNLKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLI-NRNG 62 +L VN L F G+V AVD +S+ + GE+L IVGESGSGKSV+ LS+L LI + G Sbjct: 5 ILQVNQLTTRFRTDRGVVTAVDQVSFDVAPGETLAIVGESGSGKSVTALSILGLIPSPAG 64 Query: 63 RIVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIWHRL 122 RI GE F G+DLLKL+ ++R IRG I++IFQ PM+S+NP + VG Q+ EPI H+ Sbjct: 65 RIEAGEIRFDGQDLLKLSPAKMRAIRGNRIAMIFQEPMSSMNPALTVGKQIAEPINLHQG 124 Query: 123 MKNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADEPT 182 M + A A ELL +V IPE R YP QFSGGMRQR MIAMALAC P+L+IADEPT Sbjct: 125 MPWKTALGIAGELLGKVQIPEPQSRLGAYPHQFSGGMRQRAMIAMALACKPQLIIADEPT 184 Query: 183 TALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVEEI 242 TALDVT+QAQI++LL++L + G +++ ITHDL V + DR+ MY G++VE A E+ Sbjct: 185 TALDVTVQAQILDLLKDLASQSGTALVLITHDLGVVARYADRVTVMYGGRMVETATAREL 244 Query: 243 LKTPLHPYTKGLLNSTLEI-GSRGKKLVPIPGNPPNPTKHPSGCKFHPRCSFAMEICQRE 301 P HPYT+GL+ S I G + LVPI G PP+ T P GC F PRC A + C Sbjct: 245 YGHPAHPYTRGLMASVPRIDGDTRQPLVPIDGQPPDLTALPPGCAFMPRCKLATDQCGMS 304 Query: 302 EPPLVNISENHRVACHL 318 P L + NH AC L Sbjct: 305 RPALRAVRPNHLKACFL 321 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 327 Length adjustment: 28 Effective length of query: 296 Effective length of database: 299 Effective search space: 88504 Effective search space used: 88504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory