Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate RR42_RS10820 RR42_RS10820 peptide ABC transporter ATP-binding protein
Query= TCDB::Q9X272 (328 letters) >FitnessBrowser__Cup4G11:RR42_RS10820 Length = 329 Score = 279 bits (714), Expect = 6e-80 Identities = 133/294 (45%), Positives = 198/294 (67%), Gaps = 2/294 (0%) Query: 29 ILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLLRPDGGKIFFEGKDITNLNDKE 88 + AVDG+ ++I+ GE +GLVGESGCGKSTLGR + LL+P G+I +G+ I L+ Sbjct: 34 VTHAVDGVDLQIRRGEVVGLVGESGCGKSTLGRMVAGLLQPSAGEIRVDGQRIEGLDASA 93 Query: 89 MKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKIGTKKERRKRVEELLDMVGIGRE 148 + R K+Q++FQDP SLNP++ V RI+ + +H + V L+ G+ Sbjct: 94 RRALRLKIQMVFQDPYASLNPRLRVDRIVGEGARLHGLVDAAGFDDYVSAQLERAGLDPA 153 Query: 149 FINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSALDVSIQAQIIDLLEEIQQKMGI 208 +PH+FSGGQ+QRIGIARALA+ P+ +VCDE V+ALDVSIQAQ+++L ++++++G+ Sbjct: 154 LRQRYPHQFSGGQRQRIGIARALAVQPELLVCDEAVAALDVSIQAQVLNLFMDLREQLGL 213 Query: 209 SYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKIFLNPIHPYTRALLKSVPKIPWDGQ 268 +YLFI+H+L VVEH+S +V +MYLG++VE ++IF P HPYT+ALL +P++ D + Sbjct: 214 TYLFISHDLGVVEHVSDRVVIMYLGRVVESAPTEEIFRQPNHPYTQALLAEIPRL--DSR 271 Query: 269 KQRFYSLKGELPSPIDLPKGCRFQTRCTEKKAICFEKEPELTEVEKNHFVSCHL 322 + F +++GE+PSP+ P GC F RC A C + P L + NH +CHL Sbjct: 272 HKIFTAIRGEIPSPLAPPPGCHFHPRCPHAMARCRTEVPRLRGIAVNHLSACHL 325 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 329 Length adjustment: 28 Effective length of query: 300 Effective length of database: 301 Effective search space: 90300 Effective search space used: 90300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory