Align Inositol transport system ATP-binding protein (characterized)
to candidate RR42_RS32900 RR42_RS32900 sugar ABC transporter ATPase
Query= reanno::Phaeo:GFF717 (261 letters) >FitnessBrowser__Cup4G11:RR42_RS32900 Length = 502 Score = 165 bits (418), Expect = 2e-45 Identities = 85/241 (35%), Positives = 140/241 (58%), Gaps = 3/241 (1%) Query: 6 PLIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDIL 65 PL M+GI K+F V AL VS ++PGE H LLG+NGAGKS+ +K + GV+ G+ Sbjct: 9 PLFEMRGICKNFPGVKALDDVSFAIYPGEVHMLLGENGAGKSSLMKVLCGVYVADAGEFY 68 Query: 66 FEGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYAN 125 +G P+ P D + GIA + Q +++P + +++N F+G EP +I +A Sbjct: 69 HDGSPVAITSPADTMGLGIAVIFQEFSLVPYLDIAQNIFLGREPRGRIPGSVDAARMHAE 128 Query: 126 RITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTA 185 + ++ M ++ R P +G ++Q V IA+A+ A++L+LDEPT+AL R+T Sbjct: 129 ARRILDILGMEVSTRTPVHRLGV---AQQQMVEIAKALSQNARILVLDEPTAALSDRETE 185 Query: 186 NVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEELQDMMA 245 + A I +++ GV++++I+H + A+GDR T+L G+ +G GD + +EL M Sbjct: 186 KLFAVIARLKADGVSMIYISHRMAEVFALGDRITILRDGRKVGACLPGDATPDELVARMV 245 Query: 246 G 246 G Sbjct: 246 G 246 Score = 76.3 bits (186), Expect = 1e-18 Identities = 57/220 (25%), Positives = 101/220 (45%), Gaps = 4/220 (1%) Query: 23 LAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILFEGQPLHFADPR--DAI 80 +A +++ V GE L G G+G+S + + G +G+I G+ L R + Sbjct: 277 IADINLQVRAGEIVGLAGLVGSGRSEVARAVFGADPIRQGEIYIFGKRLTGGPDRARELG 336 Query: 81 AAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYANRITMEEMRKMGINLR 140 AA I + + + +V N + +R+ P + + D A + E+ ++ I Sbjct: 337 AALIPESRKSEGLALIRTVRDNLLLAG--LRRAFPARWYRADKAEALAEREIARLRIATP 394 Query: 141 GPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTANVLATIDKVRKQGVA 200 +Q LSGG +Q + I + + AK+ I DEPT + V A + A ID + KQG Sbjct: 395 DGNQLAQFLSGGNQQKIVIGKWLVAEAKLFIFDEPTRGIDVGAKAEIFALIDSLVKQGAG 454 Query: 201 VVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEEL 240 V+ I+ + + V DR V+ G+ G +++ E + Sbjct: 455 VLLISSELPEIINVCDRTYVMRGGRIAGEVAHAEMTEERI 494 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 261 Length of database: 502 Length adjustment: 29 Effective length of query: 232 Effective length of database: 473 Effective search space: 109736 Effective search space used: 109736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory