Align Inositol transport system sugar-binding protein (characterized)
to candidate RR42_RS03370 RR42_RS03370 ABC transporter
Query= reanno::WCS417:GFF2331 (309 letters) >FitnessBrowser__Cup4G11:RR42_RS03370 Length = 325 Score = 128 bits (322), Expect = 2e-34 Identities = 94/297 (31%), Positives = 151/297 (50%), Gaps = 13/297 (4%) Query: 17 ASGVASAADLKIGVSMSAFDDTFLTYLREDMDKQAKSYPKGDGVQLQFEDARADVVKQLS 76 AS A K+GV++ + + + L + AK V + D D+ KQ S Sbjct: 32 ASAAAQRPLKKVGVTLGSLGNPYFVALAHGAEAAAKKINPDAKVTVLSADY--DLNKQFS 89 Query: 77 QVENFISQKVDAIIVNPVDTASTANIIKAATAAKIPLVFVNRRPDSQTLAPGVAAVTSDD 136 +++FI KVD I++N D + ++ A A I +V V+ A A V +D+ Sbjct: 90 HIDSFIVSKVDLILINAADARAIEPAVRKARKAGIVVVAVD-----VAAAGADATVQTDN 144 Query: 137 VEAGKLQMQYIAEKLGGKGNIVILLGDLANNSTTNRTKGVKEVLTKYPGIKI-EQEQTGI 195 AG+L ++A +LGG+GN++I G + + +R KG K VL K+PGI + +Q G Sbjct: 145 TRAGELACAFLAGRLGGRGNLIIQNGPPVS-AVLDRVKGCKMVLGKHPGIHVLSDDQDGK 203 Query: 196 WLRDRGMTLVNDWLTQGRDFQAVLSNNDEMAIGAAMALKSAGKKGVLIAGVDGTPDGLNA 255 R+ G+ ++ +LT+ AV + ND A+GA +A + + G+LIA VDG PD + A Sbjct: 204 GSREGGLNVMQLYLTRFPKIDAVFTINDPQAVGADLAARQLNRGGILIASVDGAPD-IEA 262 Query: 256 ITKGDMTV--SAFQDAKGQADKSVETARKMAKNE-PIEQNVVIPFQLITPDNVKDFK 309 K + V SA QD A +VE + + P + V++P L+T NV ++K Sbjct: 263 ALKANTLVQASASQDPWAIARTAVEIGVGLMHGQAPANRTVLLPPTLVTRANVNEYK 319 Lambda K H 0.314 0.131 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 325 Length adjustment: 27 Effective length of query: 282 Effective length of database: 298 Effective search space: 84036 Effective search space used: 84036 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory