GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PS417_11890 in Cupriavidus basilensis 4G11

Align Inositol transport system ATP-binding protein (characterized)
to candidate RR42_RS04800 RR42_RS04800 ABC transporter

Query= reanno::WCS417:GFF2332
         (517 letters)



>FitnessBrowser__Cup4G11:RR42_RS04800
          Length = 529

 Score =  278 bits (712), Expect = 3e-79
 Identities = 181/514 (35%), Positives = 276/514 (53%), Gaps = 21/514 (4%)

Query: 17  TLEEPYLLEIVNISKGFPGVVALADVQLRVRPGTVLALMGENGAGKSTLMKIIAGIYQPD 76
           TL     L + +ISK +PGV A  DV L V PG + A++GENGAGKSTLMKII G  +PD
Sbjct: 2   TLSTTPRLALAHISKRYPGVTANDDVSLVVAPGEIHAVLGENGAGKSTLMKIIFGAVKPD 61

Query: 77  AGEIRLRGKPIVFETPLAAQKAGIAMIHQELNLMPHMSIAENIWIG-----REQLNSLHM 131
           AG++   G       P  A+  GIAM+ Q  +L   +++AENI +G     +    S H 
Sbjct: 62  AGDMHFNGARAAIHNPHDARNLGIAMVFQHFSLFDTLTVAENIALGLPRGSKTAAGSPHA 121

Query: 132 -VNHREMHRCTAELLARLRINLDPEEQVGNLSIAERQMVEIAKAVSYDSDILIMDEPTSA 190
             N +++     E   R  + L+P   V  LS+ ERQ VEI +A+     +LI+DEPTS 
Sbjct: 122 GTNMKQLAEQIRETALRYGLPLEPNRHVHTLSVGERQRVEIVRALLAKPQLLILDEPTSV 181

Query: 191 ITEKEVAHLFSIIADLKSQGKGIVYITHKMNEVFAIADEVAVFRDGHYIGLQRADSMNSD 250
           +T + V  LF  +  L ++G  I+YI+HK++E+  +     V R G   G+      ++ 
Sbjct: 182 LTPQAVQTLFITLRQLAAEGTSILYISHKLDEIRELCHSATVMRMGRVTGVCDPRQESAA 241

Query: 251 SLISMMVGRELSQLFPLRETPIGDLLLTVRDLTLD------GVFKDVSFDLHAGEILGIA 304
           SL  +M+G E  +   ++  P G   L VR+L+L            +S DL AGEI+GIA
Sbjct: 242 SLSRLMIGGEPPREARVQTEP-GVCRLAVRELSLPRSHAFATELAGISLDLRAGEIVGIA 300

Query: 305 GLMGSGRTNVAETIFG-ITPSSSGQITLDGKAVRISDPHMAIEKGFALLTEDRKLSGLFP 363
           G+ G+G+  +   + G    ++   ITLD K V   D       G A + E+R   G  P
Sbjct: 301 GVSGNGQQELLAALSGEDVRAARDAITLDNKPVGKLDARQRRRAGLAFVPEERLGRGAVP 360

Query: 364 CLSVLENMEMAVLPH----YTGNGFIQQKALRALCEDMCKKLRVKTPSLEQCIDTLSGGN 419
            +S+  N+   +L H    Y   G I  KA   L + +  +LRVK         +LSGGN
Sbjct: 361 GMSLAANI---LLSHQSAPYVQRGMISPKAAAGLAQAVIARLRVKASGPHALAKSLSGGN 417

Query: 420 QQKALLARWLMTNPRLLILDEPTRGIDVGAKAEIYRLIAFLASEGMAVIMISSELPEVLG 479
            QK ++ R + + P++LI+ +PT G+DVGA A+I+  +  L + G A++++S EL E+  
Sbjct: 418 LQKFIVGREIESGPKVLIVAQPTWGVDVGAAAQIHNELLALKATGCALLVVSEELDELFA 477

Query: 480 MSDRVMVMHEGELMGTLDRSEATQEKVMQLASGM 513
           + DR+ V+ +G L  ++   +AT+E+V    SG+
Sbjct: 478 ICDRLHVIAKGRLSPSIPTRDATREQVGLWMSGL 511


Lambda     K      H
   0.320    0.136    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 593
Number of extensions: 27
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 517
Length of database: 529
Length adjustment: 35
Effective length of query: 482
Effective length of database: 494
Effective search space:   238108
Effective search space used:   238108
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory