Align Inositol ABC transport system, permease protein IatP, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized)
to candidate RR42_RS32895 RR42_RS32895 ABC transporter permease
Query= TCDB::B8H230 (332 letters) >FitnessBrowser__Cup4G11:RR42_RS32895 Length = 318 Score = 195 bits (495), Expect = 1e-54 Identities = 108/307 (35%), Positives = 177/307 (57%), Gaps = 5/307 (1%) Query: 20 LAFARKHRTILFLLLLVAVFGAANERFLTARNALNILSEVSIYGIIAVGMTFVILIGGID 79 L+ + ++ LLLL F FL+ N LNI ++ +I +IA+ MT +I+ G+D Sbjct: 13 LSIGKVPGSVWVLLLLSLGFSVTGPGFLSVENLLNIGAQSTILLLIALPMTLIIMTEGLD 72 Query: 80 VAVGSLLAFASIAAAYVVTAVVGDGPATWLIALLVSTLIGLAGGYVQGKAVTWLHVPAFI 139 +++G++L + A V+ A + +AL + L GLA G + G V+WL +P F+ Sbjct: 73 LSMGAVLTLCGVVLAMVMVAT-----ESLPLALGAALLTGLAFGLLNGALVSWLEIPPFV 127 Query: 140 VTLGGMTVWRGATLLLNDGGPISGFNDAYRWWGSGEILFLPVPVVIFALVAAAGHVALRY 199 TLG + V +G L+ DG ++G +A +G++L +P+P+ I A+ H L + Sbjct: 128 ATLGTLGVAQGLALVATDGQSVTGIGEAIPLIYAGQLLGVPLPIWIAAVFYGLFHWLLYH 187 Query: 200 TRYGRQVYAVGGNAEAARLSGVNVDFITTSVYAIIGALAGLSGFLLSARLGSAEAVAGTG 259 TR+G V+A+GGN EA + SGV ++ +VYA+ G +AG++ LL+AR+ + A G Sbjct: 188 TRFGAYVFALGGNREALKFSGVRINVYLIAVYALGGLMAGVAALLLTARMNAGHPTAAIG 247 Query: 260 YELRVIASVVIGGASLTGGSGGVGGTVLGALLIGVLSNGLVMLHVTSYVQQVVIGLIIVA 319 E IA+V +GG + G+G + GTVLG L +GVL NGL ++ V S VQ IGL+++ Sbjct: 248 LEFDAIAAVAVGGTTFDRGNGWLPGTVLGVLAVGVLRNGLNLVGVPSSVQVAAIGLLVLV 307 Query: 320 AVAFDHY 326 + + + Sbjct: 308 VLLIESF 314 Lambda K H 0.325 0.140 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 318 Length adjustment: 28 Effective length of query: 304 Effective length of database: 290 Effective search space: 88160 Effective search space used: 88160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory