Align scyllo-inosose 3-dehydrogenase; 2-keto-myo-inositol dehydrogenase; EC 1.1.1.- (characterized)
to candidate RR42_RS09405 RR42_RS09405 butanediol dehydrogenase
Query= SwissProt::Q9WYP3 (395 letters) >FitnessBrowser__Cup4G11:RR42_RS09405 Length = 357 Score = 145 bits (367), Expect = 1e-39 Identities = 121/354 (34%), Positives = 170/354 (48%), Gaps = 42/354 (11%) Query: 34 VWR-YPEVRVEEVPEPRIEKPTEIIIKVKA--CGICGSDVHMAQTDEEGYILYPGLTGFP 90 VWR +VRVEEV P +KP E +K++ CGICGSD+H G + P P Sbjct: 5 VWRGRHDVRVEEVRVP--DKPAEGWVKIRVHWCGICGSDLHEYVA---GPVFIPVDHPHP 59 Query: 91 VT-------LGHEFSGVVVEAGPEAINRRTNKRFEIGEPVCAEEMLWCGHCRPCAEGFPN 143 +T LGHEFSG + E G F++GE V A+ CG C C G N Sbjct: 60 LTGLKGQCILGHEFSGEIAELGAGVTG------FKVGERVTADACQHCGKCYYCTHGLYN 113 Query: 144 HCENLNELGFNVDGAFAEYVKVDAKYAWSLRELEGVYEGDRLFLAGSLVEPTSVAYNAVI 203 CE+L G +GAFAEYV V A+ + L E AG+L+EP +V +AV Sbjct: 114 ICESLAFTGLMNNGAFAEYVNVPAELLYKLPENFPTE-------AGALIEPLAVGLHAVK 166 Query: 204 VRGGGIRPGDNVVILGGGPIGLAAVAILKHAGASKVILSEPSEVRRNLAKELGADHVIDP 263 G + G VV++G G IGL + K AGA ++I E S R+ A E+GA+ VIDP Sbjct: 167 KAGNIV--GQTVVVVGAGTIGLCTIMCAKAAGAGRIIALEMSSARKKKALEVGANVVIDP 224 Query: 264 TKENFVEAVLDYTNGLGAKLFLEATGVPQLVWPQIEEVIWRARGINATVAIVARADAKIP 323 + + + V T G GA + E G I+ + R G V I P Sbjct: 225 KECDAIAQVKALTGGYGADVSFECIGNKATAKLAIDVI--RKAGKCVMVGIFEE-----P 277 Query: 324 LTGEVFQV--RRAQIVGSQGHSGHGTFPRVISLMASG-MDMTKIISKTVSMEEI 374 F++ +I+GS ++G F VI +A G +D+ +I+ +S+ +I Sbjct: 278 SAFNFFEIVSTEKEIIGSLAYNGE--FADVIRFIADGRIDVQPLITGRISLADI 329 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 357 Length adjustment: 30 Effective length of query: 365 Effective length of database: 327 Effective search space: 119355 Effective search space used: 119355 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory