Align BadK (characterized)
to candidate RR42_RS18255 RR42_RS18255 enoyl-CoA hydratase
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__Cup4G11:RR42_RS18255 Length = 256 Score = 159 bits (403), Expect = 4e-44 Identities = 101/261 (38%), Positives = 148/261 (56%), Gaps = 13/261 (4%) Query: 6 ILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGA 65 +L G+V +ITLNRPD LN+ + L AL +A G A+++ G R F AG Sbjct: 1 MLLAWHGQVAVITLNRPDKLNSFTREMHAVLQQALDHVEAG-GARALLLTGAGRGFCAGQ 59 Query: 66 DIASMA--------AWSYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALAC 117 D+A + DV+ + I R ++++ PV+AAV G A G G LALAC Sbjct: 60 DLADLDFTPGAMTDLGELIDVWFNRLIRR----LQKLPLPVIAAVNGTAAGAGANLALAC 115 Query: 118 DIVIAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLV 177 D+V+A RSA F +K+GL+P +GGT LP+ IG A+AM + ++ L+A+EA+++GL+ Sbjct: 116 DMVLAARSASFIQAFVKIGLVPDSGGTWLLPKRIGMARAMGLAMTGDKLSADEAEKWGLI 175 Query: 178 SRVVDDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFAS 237 +DD L ++ +ALAT +AA AL A+K+++ L + ER AS Sbjct: 176 WEAMDDPLLPEQALALATHLAAQPTRALAAIKQAMYAGASQGLDAQLDLERDLQRELGAS 235 Query: 238 ADAREGIQAFLEKRAPCFSHR 258 D EG+ AFLEKRAP F+ R Sbjct: 236 PDYAEGVNAFLEKRAPRFTGR 256 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 256 Length adjustment: 24 Effective length of query: 234 Effective length of database: 232 Effective search space: 54288 Effective search space used: 54288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory