Align Benzoyl-CoA reductase electron transfer protein, putative (characterized, see rationale)
to candidate RR42_RS31315 RR42_RS31315 NADH-quinone oxidoreductase subunit F
Query= uniprot:Q39TW5 (635 letters) >FitnessBrowser__Cup4G11:RR42_RS31315 Length = 569 Score = 254 bits (649), Expect = 7e-72 Identities = 165/520 (31%), Positives = 253/520 (48%), Gaps = 60/520 (11%) Query: 23 PTKPCISVCAGAGCLASGAAEVIAAFKTELEFHGLTTEVNTKGTGCPGFCERGPIVMIYP 82 P + VC G C G +++A L +EV C G CER P ++ Sbjct: 106 PAAVTVRVCEGIACELGGGRDLLARLPALLG-----SEVKVVAAPCIGRCERAPAALVGQ 160 Query: 83 EGICYLKVKPEDVPEIVSHTIKEKKVVDRLLYEDPATGTRALRESDIPFYKNQQRNILSE 142 + + + TI + V R ++ P E+ + + Sbjct: 161 NPVDFASAQ----------TIADT-VAARAVHHAP--------EAHLGY----------- 190 Query: 143 NLRLDSKSMDDYLAIGGYSALSKVLF-QMTPEDVMGEIKKSNLRGRGGGGFPAWRKWEES 201 DDY A GGY L V + E ++ ++ S LRG GG GFP RKW Sbjct: 191 ---------DDYRAQGGYQLLRAVASGEHDSESLLRTMEDSGLRGLGGAGFPTGRKWRIV 241 Query: 202 RNAPDPIKYVIVNADEGDPGAFMDRALIEGNPHSILEGLIIGAYAVGAHEGFIYVRQEYP 261 P P + + VN DEG+PG F DR +E +PH LEG++I A +IY+R EY Sbjct: 242 MAEPAP-RLMAVNLDEGEPGTFKDRVYLERDPHRFLEGMLIAAAVTQVSAIYIYLRDEYA 300 Query: 262 LAVENINLAIRQASERGFVGKDILGSGFDFTVKVHMGAGAFVCGESSALMTALEGRAGEP 321 + A+R+ + D+ +++ GAGA++CGE SA++ ++EG+ G P Sbjct: 301 GCRAVLGQALRRLQAEPPI-PDMP------QIQLRRGAGAYICGEESAMIESIEGKRGMP 353 Query: 322 RPKYIHTAVKGVWDHPSVLNNVETWANVTQIITKGADWFTSYGTAGSTGTKIFSLVGKIT 381 R + + A G++ P++ +N ET V +I+ KGA WF + G G G + FS+ G++ Sbjct: 354 RLRPPYVAQVGLFGRPTLEHNFETLYWVREILEKGAGWFAAQGRHGRHGLRSFSVSGRVK 413 Query: 382 NTGLVEVPMGVTLRDIITKVGGGIPGGKKFKAVQTGGPSGGCIPEAMLDLPVDFDELTKA 441 G+ P G+T+ ++I + GG+ G F GG SGG +P ++ D+P+DFD L Sbjct: 414 LPGVHVAPAGITVSELIEEYCGGMQDGHCFYGYLPGGASGGILPASLGDIPLDFDTLQPY 473 Query: 442 GSMMGSGGMIVMDEDTCMVDIARYFIDFLKDESCGKCTPCREGIRQMLAVLTRITVGKGK 501 G +GS ++V E V +AR + F K ESCG+CTPCR G + L V+ + Sbjct: 474 GCFIGSAAIVVFSEQDSAVAVARNLMHFFKHESCGQCTPCRVGTAKALDVIAQ------P 527 Query: 502 EGDIELLEEL-AESTGAALCALGKSAPNPVLSTIRYFRDE 540 + D+ L +L A A++C LG++APNPV I+YF E Sbjct: 528 KWDLAALADLSAVMRDASICGLGQAAPNPVDCVIKYFPQE 567 Lambda K H 0.319 0.138 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 872 Number of extensions: 50 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 635 Length of database: 569 Length adjustment: 37 Effective length of query: 598 Effective length of database: 532 Effective search space: 318136 Effective search space used: 318136 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory